Clone Name | rbastl05h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PHSA_SALTY (P37600) Thiosulfate reductase precursor (EC 1.-.-.-) | 28 | 5.0 |
---|
>PHSA_SALTY (P37600) Thiosulfate reductase precursor (EC 1.-.-.-)| Length = 758 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 53 SSKDVTFSTHLIHIQISLRSKDTTSSTPTCP 145 SSK + S+HL H+ + S +T + TCP Sbjct: 145 SSKSGSLSSHLFHLATAFGSPNTFTHASTCP 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,179,166 Number of Sequences: 219361 Number of extensions: 522197 Number of successful extensions: 1457 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1457 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)