Clone Name | rbastl05g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UL21_PRVN3 (Q00703) Protein UL21 homolog | 29 | 2.5 | 2 | NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 pr... | 28 | 5.6 |
---|
>UL21_PRVN3 (Q00703) Protein UL21 homolog| Length = 523 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 245 GDVSRLIISTCMVHAPACLDRSGLRRP 325 G+V R++++ +VHAPA D +G P Sbjct: 384 GEVMRMLVNAAVVHAPAIADPAGASPP 410
>NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 precursor (Notch| 3) [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2321 Score = 28.1 bits (61), Expect = 5.6 Identities = 23/82 (28%), Positives = 32/82 (39%) Frame = +2 Query: 101 VRSL*LKPLIMMTTATTPAQINQSSNLNQRHCMQLHANPSACTYPRGCGDVSRLIISTCM 280 VR+L L L+ A P ++ S N C QL + +AC P G + C Sbjct: 24 VRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPC- 82 Query: 281 VHAPACLDRSGLRRPCAPGTGR 346 H+ C R + GT R Sbjct: 83 -HSGPCAGRGVCQSSVVAGTAR 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,455,537 Number of Sequences: 219361 Number of extensions: 784504 Number of successful extensions: 1750 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1750 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)