Clone Name | rbastl05f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y163_SYNY3 (Q55563) Hypothetical WD-repeat protein sll0163 | 30 | 2.9 | 2 | PKHA6_MOUSE (Q7TQG1) Pleckstrin homology domain-containing famil... | 28 | 8.6 | 3 | PKHA6_HUMAN (Q9Y2H5) Pleckstrin homology domain-containing famil... | 28 | 8.6 |
---|
>Y163_SYNY3 (Q55563) Hypothetical WD-repeat protein sll0163| Length = 1693 Score = 29.6 bits (65), Expect = 2.9 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -3 Query: 332 NVERERETLLRSAIVYPLVCLLLAVKI*GQD 240 N+E++ + +L+ +VYPL LL AVK GQD Sbjct: 942 NLEKQCQFILKQFLVYPLEALLAAVKT-GQD 971
>PKHA6_MOUSE (Q7TQG1) Pleckstrin homology domain-containing family A member 6| (Phosphoinositol 3-phosphate-binding protein 3) (PEPP-3) Length = 1173 Score = 28.1 bits (61), Expect = 8.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 62 KQWQRRWYMYVRSCLMCY 9 KQW +RW++ V CL Y Sbjct: 75 KQWNKRWFVLVDRCLFYY 92
>PKHA6_HUMAN (Q9Y2H5) Pleckstrin homology domain-containing family A member 6| (Phosphoinositol 3-phosphate-binding protein 3) (PEPP-3) Length = 1048 Score = 28.1 bits (61), Expect = 8.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 62 KQWQRRWYMYVRSCLMCY 9 KQW +RW++ V CL Y Sbjct: 75 KQWNKRWFVLVDRCLFYY 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,550,049 Number of Sequences: 219361 Number of extensions: 625292 Number of successful extensions: 1029 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)