ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl05f04 |
|---|---|
| Clone Library Name | barley_pub |
>CRYD_BRARE (Q4KML2) Cryptochrome DASH (Protein CRY-DASH) (zCRY-DASH)| Length = 520 Score = 30.0 bits (66), Expect = 1.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 14 TMPEWVRHTGYKKSGTRAEKYRQVSSCVCR 103 T PEW RH K SG + K R+ SS R Sbjct: 474 TAPEWSRHVNNKSSGPSSSKGRKGSSYTAR 503
>VLDLR_RAT (P98166) Very low-density lipoprotein receptor precursor (VLDL| receptor) (VLDL-R) Length = 873 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 102 GVGNCLHRPWQCSTFPSASDMGISVTC 182 G G C+H+ W+C P D V C Sbjct: 247 GSGECIHKKWRCDGDPDCKDGSDEVNC 273
>VLDLR_RABIT (P35953) Very low-density lipoprotein receptor precursor (VLDL| receptor) (VLDL-R) Length = 873 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 102 GVGNCLHRPWQCSTFPSASDMGISVTC 182 G G C+H+ W+C P D V C Sbjct: 247 GSGECIHKKWRCDGDPDCKDGSDEVNC 273
>VLDLR_MOUSE (P98156) Very low-density lipoprotein receptor precursor (VLDL| receptor) (VLDL-R) Length = 873 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 102 GVGNCLHRPWQCSTFPSASDMGISVTC 182 G G C+H+ W+C P D V C Sbjct: 247 GSGECIHKKWRCDGDPDCKDGSDEVNC 273
>VLDLR_HUMAN (P98155) Very low-density lipoprotein receptor precursor (VLDL| receptor) (VLDL-R) Length = 873 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 102 GVGNCLHRPWQCSTFPSASDMGISVTC 182 G G C+H+ W+C P D V C Sbjct: 247 GSGECIHKKWRCDGDPDCKDGSDEVNC 273
>VLDLR_CHICK (P98165) Very low-density lipoprotein receptor precursor (VLDL| receptor) (VLDL-R) (Vitellogenin receptor) (VTG receptor) Length = 863 Score = 29.6 bits (65), Expect = 2.3 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 102 GVGNCLHRPWQCSTFPSASDMGISVTC 182 G G C+H+ W+C P D + C Sbjct: 265 GSGECIHKKWRCDGDPDCKDGSDEINC 291
>NFX1_HUMAN (Q12986) Transcriptional repressor NF-X1 (EC 6.3.2.-) (Nuclear| transcription factor, X box-binding, 1) Length = 1104 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -3 Query: 149 GKCRTLPWSVQTIAHPCK---RMRKPDDIFLHACHFSCNPCAAP 27 GK + WS I H C R ++P H+C+ C+P P Sbjct: 408 GKVKNPEWSRNEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCP 451
>LRP5_HUMAN (O75197) Low-density lipoprotein receptor-related protein 5 precursor| Length = 1615 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/43 (32%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 87 PHAFA---GVGNCLHRPWQCSTFPSASDMGISVTCSKCVVCQF 206 P FA G +C+ W+C FP D C C QF Sbjct: 1261 PDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQF 1303
>LRP5_MOUSE (Q91VN0) Low-density lipoprotein receptor-related protein 5 precursor| (LRP7) (Lr3) Length = 1614 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 87 PHAFA---GVGNCLHRPWQCSTFPSASDMGISVTCSKCVVCQF 206 P FA G +C+ W+C FP +D C C QF Sbjct: 1260 PDQFACTTGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQF 1302
>LRP3_HUMAN (O75074) Low-density lipoprotein receptor-related protein 3| precursor (hLRp105) Length = 770 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 108 GNCLHRPWQCSTFPSASDMGISVTCS 185 G CL PWQC+T D CS Sbjct: 176 GKCLPGPWQCNTVDECGDGSDEGNCS 201
>LRP2_HUMAN (P98164) Low-density lipoprotein receptor-related protein 2 precursor| (Megalin) (Glycoprotein 330) (gp330) Length = 4655 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +3 Query: 108 GNCLHRPWQCSTFPSASDMGISVTC 182 GNC+HR W C DM C Sbjct: 1281 GNCIHRAWLCDRDNDCGDMSDEKDC 1305
>SYD_CHLTE (Q8KCT7) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 603 Score = 28.1 bits (61), Expect = 6.5 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 5/41 (12%) Frame = +1 Query: 34 AHGLQEKW--HACRKI---SSGFLMRLQGWAIVCTDHGNVL 141 A GLQ ++ H C ++ S G L+R+ GW DHG ++ Sbjct: 8 ADGLQNRFRTHYCGRLNRKSEGELVRIAGWVHRIRDHGGLI 48
>CO8B_PAROL (Q9PVW7) Complement component C8 beta chain precursor (Complement| component 8 beta subunit) Length = 588 Score = 27.7 bits (60), Expect = 8.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 108 GNCLHRPWQCSTFPSASDMGISVTCSK 188 G C+HR QC+ DM V C K Sbjct: 127 GRCIHRTLQCNGEDDCGDMSDEVGCKK 153
>HYIN_PANAY (Q47860) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 460 Score = 27.7 bits (60), Expect = 8.6 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 108 GNCLHRPWQCSTFPSASDMGISV 176 G C+ RPW + S SD G SV Sbjct: 148 GGCVSRPWSAGLYRSPSDTGGSV 170
>LDLR_HUMAN (P01130) Low-density lipoprotein receptor precursor (LDL receptor)| Length = 860 Score = 27.7 bits (60), Expect = 8.6 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 108 GNCLHRPWQCSTFPSASDMGISVTCSKCVVCQ 203 GNC+H QC DM V C +C+ Sbjct: 246 GNCIHGSRQCDREYDCKDMSDEVGCVNVTLCE 277 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,675,706 Number of Sequences: 219361 Number of extensions: 672195 Number of successful extensions: 2071 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2071 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
