Clone Name | rbastl05e10 |
---|---|
Clone Library Name | barley_pub |
>PDR1_ORYSA (Q7PC80) Probable pleiotropic drug resistance protein 1| Length = 1468 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 297 NPFHHFS*SVDCCPIWWAWNCTCCSSDFTVF 205 N F F S P+WW W C C +T++ Sbjct: 1373 NLFTGFVISRPATPVWWRWYCWICPVAWTLY 1403
>MTS1_STRSA (P29347) Modification methylase StsI (EC 2.1.1.72)| (Adenine-specific methyltransferase StsI) (M.StsI) Length = 653 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +1 Query: 43 KYMFL*TRCQAFPKNINSVLQV*HGGEKQSIHLQNSANVPFGTRDDELNRLFGY 204 KY L FPKNIN+ + + GG I+++ + F + +N +F Y Sbjct: 373 KYKLLNQILPLFPKNINTFVDIFSGGANVGINVKAKKYI-FNDMNTRINEMFRY 425
>SHBG_PHOSU (Q62588) Sex hormone-binding globulin precursor (SHBG) (Sex| steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) Length = 399 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 132 NSLAKFCKCSFWNEG*RVESTLRI*RQ*NHWNNMCNSMP 248 NS A FC W +G R++ + R N W + C P Sbjct: 353 NSSASFCLSDLWVQGQRLDIDQALNRSQNIWTHSCPHSP 391
>SHBG_MOUSE (P97497) Sex hormone-binding globulin precursor (SHBG) (Sex| steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) Length = 403 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 132 NSLAKFCKCSFWNEG*RVESTLRI*RQ*NHWNNMCNSMPTIWGNNLQTS 278 +S A FC FW +G R++ + R + W + C P+ N+ +TS Sbjct: 357 SSSASFCLSDFWVQGQRLDIDQALSRSQDIWTHSCPQRPS---NDTRTS 402
>PDR3_ORYSA (Q8GU90) Pleiotropic drug resistance protein 3| Length = 1457 Score = 28.5 bits (62), Expect = 4.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 258 PIWWAWNCTCCSSDFTVF 205 PIWW W C C +T++ Sbjct: 1375 PIWWRWYCWACPVAWTLY 1392
>PDR2_ORYSA (Q8GU92) Probable pleiotropic drug resistance protein 2| Length = 1464 Score = 28.1 bits (61), Expect = 5.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 258 PIWWAWNCTCCSSDFTVF 205 PIWW W C C +T++ Sbjct: 1382 PIWWRWYCWICPVAWTLY 1399
>SHBG_RABIT (P15196) Sex hormone-binding globulin precursor (SHBG) (Sex| steroid-binding protein) (SBP) (Testis-specific androgen-binding protein) (ABP) Length = 398 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +3 Query: 132 NSLAKFCKCSFWNEG*RVESTLRI*RQ*NHWNNMCNSMPTIWGNNLQTS 278 +S A FC W +G +++ + R + W + C S P GN TS Sbjct: 352 DSSASFCLDGLWAQGQKLDMDKALNRSQDIWTHSCPSSP---GNGTDTS 397
>PDR4_ORYSA (Q8GU89) Pleiotropic drug resistance protein 4| Length = 1450 Score = 27.7 bits (60), Expect = 7.1 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 258 PIWWAWNCTCCSSDFTVF 205 P+WW W C C +T++ Sbjct: 1367 PVWWRWYCWICPVAWTLY 1384
>C4AA1_DROME (Q9V7G5) Probable cytochrome P450 4aa1 (EC 1.14.-.-) (CYPIVAA1)| Length = 514 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 362 LLPAVRTL-RKLGLSSEEENKLIIHFTISASL*IVAPYGGHGIAHVVP 222 L P+V + RKLG EE +L H + S + PY H +AH+ P Sbjct: 378 LYPSVPLIARKLG----EEVRLAKHTLPAGSNVFICPYATHRLAHIYP 421
>SRB8_YEAST (P25648) Suppressor of RNA polymerase B SRB8| Length = 1427 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 229 LFQ*FYCLYIRRVDSTRHPSFQKEHLQNFASELI 128 +FQ F C I+++ P+ E L+NF ++I Sbjct: 1088 VFQAFTCFCIKKIMENNEPAMAMEDLKNFIFQII 1121
>FSHB_MASCO (Q6SI68) Follitropin beta chain precursor (Follicle-stimulating| hormone beta subunit) (FSH-beta) (FSH-B) Length = 130 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = -3 Query: 273 SVDCCPIWWAWNCTCCSS----DFTVFISEESIQLVI 175 S+ C + W W CC S + T+ I +E + I Sbjct: 4 SIQLCILLWCWRAICCHSCELTNITISIEKEECRFCI 40
>MPIP1_CAEEL (O44552) M-phase inducer phosphatase cdc-25.1 (EC 3.1.3.48) (Cell| division cycle-related protein 25.1) Length = 604 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 139 LQNSANVPFGTRDDELNRLFGYKDSKITGTTC-AIPCPPYGATIYRLA 279 L N + PFG DDE+ ++S++ T+ A P P +++ LA Sbjct: 178 LNNPRDDPFGDEDDEVFEQSNVRNSQVQNTSIFAQPAPRTATSLWDLA 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,593,877 Number of Sequences: 219361 Number of extensions: 1116003 Number of successful extensions: 2436 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2436 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)