Clone Name | rbastl05e06 |
---|---|
Clone Library Name | barley_pub |
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 28.9 bits (63), Expect = 3.1 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +1 Query: 1 QSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDHCISRGH 153 + R+ PE ++L TPTQ F +HR+ +K+A + KG + GH Sbjct: 565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>HNK2_XENLA (P42587) Homeobox protein XENK-2| Length = 196 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 1 QSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 123 + R+ PE ++L TPTQ F +HR+ K+A S KG+ Sbjct: 89 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGM 133
>FDHE_AQUAE (O67150) Protein fdhE homolog| Length = 283 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 116 FHDEAFFDKKRWCKNRCEVC 57 F D+ F+ +RW KN C VC Sbjct: 151 FADKVKFEHERWFKNYCPVC 170
>NX22A_BRARE (Q90481) Homeobox protein Nkx-2.2a (Homeobox protein NK-2 homolog| B) Length = 269 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +1 Query: 1 QSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDH 135 + R+ PE ++L TPTQ F +HR+ K+A + KG+ H Sbjct: 145 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTH 193
>CHMU_ARATH (P42738) Chorismate mutase, chloroplast precursor (EC 5.4.99.5)| (CM-1) Length = 334 Score = 27.7 bits (60), Expect = 6.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 344 GRQLSCDAICCNCVM*EVHFASFI 273 G CDAIC C+ +H+ F+ Sbjct: 207 GSTAVCDAICLQCLSKRIHYGKFV 230
>RL1D1_PONPY (Q5RCE6) Ribosomal L1 domain-containing protein 1| Length = 490 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 237 NVQKIKERDEKRKIARKSVLRLKMDLQLVSSGDAMI 130 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>RL1D1_HUMAN (O76021) Ribosomal L1 domain-containing protein 1 (Cellular| senescence-inhibited gene protein) (PBK1 protein) (CATX-11) Length = 490 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 237 NVQKIKERDEKRKIARKSVLRLKMDLQLVSSGDAMI 130 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>HISX_BLOFL (Q7VQX0) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 437 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 142 RCNDLSQLPSMMRPFLTKNGGVRIDVKFVL 53 RC+ QL + RP N + +DVK++L Sbjct: 14 RCSISEQLTLLTRPINKHNNSIHLDVKYIL 43
>HSDR_STAAN (Q7A801) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 104 AFFDKKRWCKNRCEV 60 +F DKK WCKN+ +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>HSDR_STAAM (Q99X26) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 104 AFFDKKRWCKNRCEV 60 +F DKK WCKN+ +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>ERG6_PNECA (Q96WX4) Sterol 24-C-methyltransferase (EC 2.1.1.41)| (Delta(24)-sterol C-methyltransferase) Length = 377 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 306 CHVGGPLCQ---FHTTGTVG**RCFYNVQKIKERDEKRKIARK 187 C VGGP CQ F VG Y +Q+ K EK+ ++ K Sbjct: 135 CGVGGPACQISVFTGANIVGLNNNDYQIQRAKYYSEKKGLSDK 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,521,037 Number of Sequences: 219361 Number of extensions: 987301 Number of successful extensions: 2514 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2514 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)