| Clone Name | rbastl05e04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYV_FUSNN (Q8RHK3) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 29 | 4.9 | 2 | SYV_GEOSL (Q74BJ6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 28 | 6.4 | 3 | YD179_YEAST (Q03983) Protein YDR179W-A | 28 | 8.3 | 4 | ULA1_RAT (Q9Z1A5) NEDD8-activating enzyme E1 regulatory subunit ... | 28 | 8.3 | 5 | ULA1_MOUSE (Q8VBW6) NEDD8-activating enzyme E1 regulatory subuni... | 28 | 8.3 |
|---|
>SYV_FUSNN (Q8RHK3) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 887 Score = 28.9 bits (63), Expect = 4.9 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 412 RNLAENVWQTSLLMRRNYQPFDVDSVEPLPLDH 314 RN A +W + + N + FDV SV+ LD+ Sbjct: 576 RNFANKIWNATRFVIMNLKGFDVKSVDKTKLDY 608
>SYV_GEOSL (Q74BJ6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 887 Score = 28.5 bits (62), Expect = 6.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 412 RNLAENVWQTSLLMRRNYQPFDVDSVEPLPLD 317 RN +W S N + F+ D+V+P LD Sbjct: 575 RNFVNKIWNASRFALMNLEGFEPDTVDPATLD 606
>YD179_YEAST (Q03983) Protein YDR179W-A| Length = 463 Score = 28.1 bits (61), Expect = 8.3 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +2 Query: 134 SQISNLQQAMYITWSNISTTTSYSPRASADLQYELGHKLFQN 259 S+++ L + MY T+ NI T SP +L L H LF N Sbjct: 345 SKLNALNRVMYRTFDNIVQTKITSPVTIGNLFSLLRHSLFPN 386
>ULA1_RAT (Q9Z1A5) NEDD8-activating enzyme E1 regulatory subunit (Amyloid| protein-binding protein 1) (Amyloid beta precursor protein-binding protein 1, 59 kDa) (APP-BP1) Length = 534 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -1 Query: 327 CRWTITPNLKCLEQTLLK*YVTTFWKSLWPSSYCRSAEALGL*LVVVE 184 CR+TI + LE TLL+ W S P CR+ +G ++++ Sbjct: 121 CRFTIVVATQLLESTLLR-LADVLWNSQIPLLICRTYGLVGYMRIIIK 167
>ULA1_MOUSE (Q8VBW6) NEDD8-activating enzyme E1 regulatory subunit (Amyloid| protein-binding protein 1) (Amyloid beta precursor protein-binding protein 1, 59 kDa) (APP-BP1) Length = 534 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -1 Query: 327 CRWTITPNLKCLEQTLLK*YVTTFWKSLWPSSYCRSAEALGL*LVVVE 184 CR+TI + LE TLL+ W S P CR+ +G ++++ Sbjct: 121 CRFTIVVATQLLESTLLR-LADVLWNSQIPLLICRTYGLVGYMRIIIK 167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,631,304 Number of Sequences: 219361 Number of extensions: 1162823 Number of successful extensions: 2937 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2936 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)