| Clone Name | rbastl05c12 |
|---|---|
| Clone Library Name | barley_pub |
>HEMH_YEREN (P43413) Ferrochelatase (EC 4.99.1.1) (Protoheme ferro-lyase) (Heme| synthetase) Length = 322 Score = 33.9 bits (76), Expect = 0.097 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 5/113 (4%) Frame = +3 Query: 45 LVYNFHYIPRRIHLASNQLLQQC-----SIRSAIQLPL*QTDSTFSEVVYSQK*LLPLTN 209 LV +FH IP+R + Q+C ++R+ I LP Q T+ + L P T Sbjct: 189 LVLSFHGIPKRYAQLGDDYPQRCEDTSRALRAEIALPAEQIMMTYQSRFGREPWLTPYT- 247 Query: 210 NETMVTSKYQALKELVL*SKADNA*S*TNTAPCCLESLKELCQLSYAEFLFVG 368 +ET+ + Q +K + L +A CLE+L+E+ + + F+ G Sbjct: 248 DETLKSLPSQGVKHIQLICPGFSA--------DCLETLEEIKEQNREVFIHAG 292
>DMC1_LILLO (P37384) Meiotic recombination protein DMC1 homolog| Length = 349 Score = 30.0 bits (66), Expect = 1.4 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +2 Query: 41 YTCLQLPLYT*KNPSGIKPTVAAMQHQISNSTAAMTNRQYIF*SSVLPK 187 YTC L ++T KN +GIK A +I + + N YI S VL K Sbjct: 58 YTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKLVNVGYITGSDVLLK 106
>DMC1_SOYBN (Q96449) Meiotic recombination protein DMC1 homolog| Length = 345 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 41 YTCLQLPLYT*KNPSGIKPTVAAMQHQISNSTAAMTNRQYIF*SSVLPK 187 YTC L ++T KN +GIK A +I + + N YI S L K Sbjct: 54 YTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKLVNFGYITGSDALLK 102
>NPC1_PIG (P56941) Niemann-Pick C1 protein precursor| Length = 1277 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 37 LLHLFTTSIIYLEESIWHQTNCCSNAASDQQFNCRYDKP 153 LL L ++ + +W+ C A+ D+++NCRY P Sbjct: 11 LLLLLCPVQVFSQSCVWYGE--CGIASGDKRYNCRYSGP 47
>FLHC_ERWCA (Q9X601) Flagellar transcriptional activator flhC| Length = 193 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 4/51 (7%) Frame = +1 Query: 163 FLK*CTPKSDYYLLQITRLWLL----QSIKL*KNSCSNPRLTMPNPRRTQP 303 +L+ C P+SD LL +TR W L S L +SC+ + PR QP Sbjct: 102 YLEQCAPQSDSPLLALTRAWTLVRFVDSGMLQLSSCNCCKGMFIYPRLHQP 152
>TMKL1_ARATH (P33543) Putative kinase-like protein TMKL1 precursor| Length = 674 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 142 YDKPTVHFLK*CTPKSDYYLLQITRLWLLQSIK 240 Y P +H +K C P+SD Y I L +L K Sbjct: 542 YKAPELHKMKKCNPRSDVYAFGILLLEILMGKK 574
>NAS34_CAEEL (Q21059) Zinc metalloproteinase nas-34 precursor (EC 3.4.24.21)| (Nematode astacin 34) (Defective hatching protein 1) Length = 605 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 347 IGKLTKFFQALQTAWGCVRLG 285 IGK+++F Q + WGC LG Sbjct: 195 IGKVSRFPQDVSIGWGCTSLG 215
>FRDC_HAEDU (P59841) Fumarate reductase subunit C| Length = 128 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -1 Query: 317 LQTAWGCVRLGLGIVSLGLEHEFFQSLIL*SNHSLVICKR**SLLGVHY 171 + T W C+ L G++SLG H ++ I S + LV+ SL G+ Y Sbjct: 34 IATIWFCLVLLYGVISLGGRH--IENFISFSQNPLVVILNIISLAGLLY 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,753,728 Number of Sequences: 219361 Number of extensions: 975776 Number of successful extensions: 1944 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1944 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)