Clone Name | rbastl05c09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NELL1_RAT (Q62919) Protein kinase C-binding protein NELL1 precur... | 29 | 2.8 | 2 | NELL1_HUMAN (Q92832) Protein kinase C-binding protein NELL1 prec... | 29 | 3.6 | 3 | VCAP_HHV7J (P52347) Major capsid protein (MCP) | 28 | 6.2 |
---|
>NELL1_RAT (Q62919) Protein kinase C-binding protein NELL1 precursor (NEL-like| protein 1) Length = 810 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 212 FHGQLLASSYSFVAR*LNECRGGVYI*IEAYC--FSCFLMDEYLP 84 + G++LA + + ECRGGV + I C +C D LP Sbjct: 337 YGGKVLAEGQRILTKTCRECRGGVLVKITEACPPLNCSAKDHILP 381
>NELL1_HUMAN (Q92832) Protein kinase C-binding protein NELL1 precursor (NEL-like| protein 1) (Nel-related protein 1) Length = 810 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 212 FHGQLLASSYSFVAR*LNECRGGVYI*IEAYC--FSCFLMDEYLP 84 + G++LA + + ECRGGV + I C +C D LP Sbjct: 337 YGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILP 381
>VCAP_HHV7J (P52347) Major capsid protein (MCP)| Length = 1345 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 116 FSCFLMDEYLPYICGLFGVKTYTYMHVFGRRKQRSG 9 F+ F D P ICGL ++ TY+++F ++ G Sbjct: 916 FNRFFSD---PIICGLMNIEVQTYLNIFPHYQRNDG 948 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,987,275 Number of Sequences: 219361 Number of extensions: 634328 Number of successful extensions: 1079 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1079 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)