Clone Name | rbastl05c04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YNE2_YEAST (P53958) Hypothetical 43.7 kDa protein in YIP3-TFC5 i... | 31 | 0.74 | 2 | PIK1_YEAST (P39104) Phosphatidylinositol 4-kinase PIK1 (EC 2.7.1... | 30 | 2.2 |
---|
>YNE2_YEAST (P53958) Hypothetical 43.7 kDa protein in YIP3-TFC5 intergenic| region Length = 396 Score = 31.2 bits (69), Expect = 0.74 Identities = 20/58 (34%), Positives = 28/58 (48%) Frame = +3 Query: 15 RLQASINFTEQRIHFWIRNSSLVVSSSPHVTDGNQPTR*SDNDEGLKSSSELPDVAGA 188 +L +S +IH V +SSP GNQP +N EG +SS LP + G+ Sbjct: 77 KLASSSGLPINQIHKLFNTDHGVPASSPMKAGGNQP---HNNTEGTQSSENLPRLNGS 131
>PIK1_YEAST (P39104) Phosphatidylinositol 4-kinase PIK1 (EC 2.7.1.67)| (PI4-kinase) (PtdIns-4-kinase) Length = 1066 Score = 29.6 bits (65), Expect = 2.2 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = +3 Query: 30 INFTEQRIHFWIRNSSLVVSSSPH--VTDGNQPTR*SDNDEGLKSSSELPDVAGAHLADD 203 +N+ ++ + RN S + S++ V D N + +EGL S+S + AH+ + Sbjct: 555 LNYMNRKENNENRNESTLTSNNTRSSVYDSNSFNNGASRNEGLSSTSRSDSASTAHVRTE 614 Query: 204 LGRERARGGMVLL 242 + +E G M ++ Sbjct: 615 VNKEEDLGDMSMV 627 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,409,998 Number of Sequences: 219361 Number of extensions: 479140 Number of successful extensions: 1195 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1195 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)