| Clone Name | rbastl05b12 |
|---|---|
| Clone Library Name | barley_pub |
>BAZ2A_HUMAN (Q9UIF9) Bromodomain adjacent to zinc finger domain 2A| (Transcription termination factor I-interacting protein 5) (TTF-I-interacting protein 5) (Tip5) (hWALp3) Length = 1878 Score = 31.2 bits (69), Expect = 0.68 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = +2 Query: 182 HLVFRGSMSTAPSSSSRLHHTNHSIASTHPLWNLQQQNSPPPGSLL 319 H G +++AP SSS H +H + LWN Q S PGS L Sbjct: 66 HTTTSGILNSAPHSSST-SHLHHPSVAYDCLWNYSQYPSANPGSNL 110
>BAZ2A_MOUSE (Q91YE5) Bromodomain adjacent to zinc finger domain 2A| (Transcription termination factor I-interacting protein 5) (TTF-I-interacting protein 5) (Tip5) Length = 1850 Score = 30.4 bits (67), Expect = 1.2 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +2 Query: 182 HLVFRGSMSTAP--SSSSRLHHTNHSIASTHPLWNLQQQNSPPPGSLL 319 H G +++AP SS+S LHH N + LWN Q S PG+ L Sbjct: 24 HTTTSGILNSAPHSSSTSHLHHPN---VAYDCLWNYSQYPSANPGNNL 68
>V119_ASFL5 (P26703) LIS 119-1 protein precursor| Length = 119 Score = 30.0 bits (66), Expect = 1.5 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 169 NYVHTLSVQRKYVNCSFFLEPPSPYKSFHCFNSPIM 276 +Y+ S+ R + C +F++P SPY + + PI+ Sbjct: 78 DYISQCSIARYFDRCMYFIKPKSPYIHYMDCSQPIV 113
>HFE_PANTR (P60018) Hereditary hemochromatosis protein homolog precursor| (HLA-H) Length = 348 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 189 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 323 C ++ QLL L R Q+ PL+++TH+ T S T R L ++ Sbjct: 187 CPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYY 231
>HFE_HUMAN (Q30201) Hereditary hemochromatosis protein precursor (HLA-H)| Length = 348 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 189 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 323 C ++ QLL L R Q+ PL+++TH+ T S T R L ++ Sbjct: 187 CPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYY 231
>LUXS_STAES (Q8CNI0) S-ribosylhomocysteine lyase (EC 4.4.1.21) (Autoinducer-2| production protein luxS) (AI-2 synthesis protein) Length = 156 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 10/39 (25%) Frame = -1 Query: 317 AKNQVAASFAAEGSIMG----------ELKQWNDLYGEG 231 A N+V +AA S+ G + +QWND+YGEG Sbjct: 117 ACNEVQCGWAASHSLEGAKTIAQAFLDKREQWNDIYGEG 155
>LUXS_STAEQ (Q5HM88) S-ribosylhomocysteine lyase (EC 4.4.1.21) (Autoinducer-2| production protein luxS) (AI-2 synthesis protein) Length = 156 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 10/39 (25%) Frame = -1 Query: 317 AKNQVAASFAAEGSIMG----------ELKQWNDLYGEG 231 A N+V +AA S+ G + +QWND+YGEG Sbjct: 117 ACNEVQCGWAASHSLEGAKTIAQAFLDKREQWNDIYGEG 155
>NAC2_CHLRE (Q9LEM8) PsbD mRNA maturation factor Nac2, chloroplast precursor| Length = 1385 Score = 28.1 bits (61), Expect = 5.7 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = -3 Query: 231 RLEEEGAVDILPLNTKCMNIIWKVE*MANNYEKIGRLLCQNT*KDSLSP 85 RL E A+D PLNTK +N+ + E +Y + L + D LSP Sbjct: 1039 RLLFERALDAHPLNTKIINMYARFEAEEGSYREAAELYDRALQIDPLSP 1087
>HFE_RHIUN (Q9GL41) Hereditary hemochromatosis protein homolog precursor| Length = 348 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 189 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 323 C E++ LL L R Q+ PL+++TH+ + T R L F+ Sbjct: 187 CPEQLQWLLELGRGVLDQQVPPLVKVTHHVASAVTTLRCQALNFY 231
>HFE_DICSU (Q9GL42) Hereditary hemochromatosis protein homolog precursor| Length = 348 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 189 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 323 C E++ LL L R Q+ PL+++TH+ + T R L F+ Sbjct: 187 CPEQLQWLLELGRGVLDQQVPPLVKVTHHVASAVTTLRCQALNFY 231
>HFE_DICBI (Q9GL43) Hereditary hemochromatosis protein homolog precursor| Length = 348 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 189 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 323 C E++ LL L R Q+ PL+++TH+ + T R L F+ Sbjct: 187 CPEQLQWLLELGRGVLDQQVPPLVKVTHHVASAVTTLRCQALNFY 231
>HFE_CERSI (Q9GKZ0) Hereditary hemochromatosis protein homolog precursor| Length = 348 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 189 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 323 C E++ LL L R Q+ PL+++TH+ + T R L F+ Sbjct: 187 CPEQLQWLLELGRGVLDQQVPPLVKVTHHVASAVTTLRCQALNFY 231
>TRPB1_ARATH (P14671) Tryptophan synthase beta chain 1, chloroplast precursor| (EC 4.2.1.20) Length = 470 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +2 Query: 191 FRGSMSTAPSSSSRLHH 241 FR S+S+APSSSS+L H Sbjct: 10 FRASVSSAPSSSSQLTH 26
>VP3_BTV2A (Q65748) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 8 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 109 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV1S (P56582) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 8 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 109 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV1A (P20608) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 8 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 109 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV17 (P03539) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 8 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 109 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV11 (Q65749) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 8 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 109 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV10 (P12435) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 8 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 109 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,986,215 Number of Sequences: 219361 Number of extensions: 896209 Number of successful extensions: 2350 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 2304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2344 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)