| Clone Name | rbastl05b11 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 106 bits (265), Expect = 3e-23 Identities = 46/61 (75%), Positives = 56/61 (91%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTEAD 283 YA++NHYG M SGHYTA+IKLLD++RWYNFDDSH+S INE++VKSGAAYVLFYRR ++A Sbjct: 861 YALTNHYGGMGSGHYTAHIKLLDDSRWYNFDDSHISHINEDDVKSGAAYVLFYRRKSDAG 920 Query: 282 G 280 G Sbjct: 921 G 921
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 75.9 bits (185), Expect = 5e-14 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = -1 Query: 459 AVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 AVSNHYG M GHYTA+ K D+ +WY FDDS VS +E+++ S AAYVLFY+R Sbjct: 879 AVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQR 932
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 75.9 bits (185), Expect = 5e-14 Identities = 33/54 (61%), Positives = 41/54 (75%) Frame = -1 Query: 459 AVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 AVSNHYG M GHYTA+ K D+ +WY FDDS VS +E+++ S AAYVLFY+R Sbjct: 879 AVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQR 932
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 74.3 bits (181), Expect = 1e-13 Identities = 34/73 (46%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY-RRVTEA 286 YAV NHYG + GHYTAY+K +N+WY FDDS V+ E +G+AY+LFY RR + Sbjct: 1055 YAVDNHYGGLGGGHYTAYVKNFADNKWYYFDDSRVTETAPENSIAGSAYLLFYIRRHKDG 1114 Query: 285 DGAASNGTQSCVK 247 +G S+ Q ++ Sbjct: 1115 NGLGSSKLQEIIQ 1127
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 71.6 bits (174), Expect = 9e-13 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = -1 Query: 459 AVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 AVSNHYG+M GHYTAY K +WY FDDS+VS +E+++ + AAYVLFY+R Sbjct: 869 AVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQR 922
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 71.6 bits (174), Expect = 9e-13 Identities = 36/67 (53%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = -1 Query: 459 AVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY-RRVTEAD 283 AVSNHYG+M GHYTAY K +WY FDDS VS +E+++ + AAYVLFY RR E Sbjct: 868 AVSNHYGAMGVGHYTAYAKNRLNGKWYYFDDSSVSLASEDQIVTKAAYVLFYQRRDDECS 927 Query: 282 GAASNGT 262 +S G+ Sbjct: 928 STSSLGS 934
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 70.1 bits (170), Expect = 3e-12 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -1 Query: 459 AVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 AVSNHYG M GHYT + D +W+ FDD+ VS +NE +++S AAYVLFY+R Sbjct: 833 AVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQR 886
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 68.9 bits (167), Expect = 6e-12 Identities = 31/57 (54%), Positives = 39/57 (68%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVT 292 YAV NHYG + GHYTA+ K D ++Y FDDS V+ + EE + AAY+LFYRR T Sbjct: 922 YAVDNHYGGLGGGHYTAFAKNPDNGQFYCFDDSRVTPVCPEETVTSAAYLLFYRRKT 978
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 68.9 bits (167), Expect = 6e-12 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 ++VSNHYG + GHYTAY K RW+ FDD VS I+ VKS AAY+LFY Sbjct: 1054 FSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFY 1106
>UBP11_MOUSE (Q99K46) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 797 Score = 67.8 bits (164), Expect = 1e-11 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = -1 Query: 459 AVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 AVSNHYG M GHYT + D +W+ DD+ VS +NE +++S AAYVLFY+R Sbjct: 711 AVSNHYGGMRDGHYTTFACNKDSGQWHYLDDNSVSPVNENQIESKAAYVLFYQR 764
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 67.8 bits (164), Expect = 1e-11 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 ++VSNHYG + GHYTAY K RW+ FDD VS I+ V+S AAY+LFY Sbjct: 1016 FSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVRSSAAYILFY 1068
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 61.2 bits (147), Expect = 1e-09 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYR 301 YAV NH+G M++GHYTAY + ++ FDD+ + I+ E++ + +AYVLFYR Sbjct: 793 YAVDNHHGFMSNGHYTAYARDASSQTFFKFDDTAICEIDPEDIVTSSAYVLFYR 846
>UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 357 Score = 60.1 bits (144), Expect = 3e-09 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 YAVSNH G+ GHYTAY K + W++F+DS V+ ++ V+S AY+LFY Sbjct: 296 YAVSNHSGTTMGGHYTAYCKSPISSEWHSFNDSRVTPMSSSHVRSSDAYLLFY 348
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 59.3 bits (142), Expect = 5e-09 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 289 H+G+ +SGHY AY + N WY FDD V+ ++E V++ AYVLFYR+ +E Sbjct: 665 HHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSE 717
>UBP11_CANFA (Q01988) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 445 Score = 59.3 bits (142), Expect = 5e-09 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = -1 Query: 459 AVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 AVSNHYG + GHYT + D + FDD+ VS + E +++S AAYVLFY+R Sbjct: 358 AVSNHYGGLRDGHYTTFACNKDSGQSDYFDDNSVSPVTENQIESKAAYVLFYQR 411
>UBP19_HUMAN (O94966) Ubiquitin carboxyl-terminal hydrolase 19 (EC 3.1.2.15)| (Ubiquitin thioesterase 19) (Ubiquitin-specific-processing protease 19) (Deubiquitinating enzyme 19) (Zinc finger MYND domain-containing protein 9) (Fragment) Length = 1371 Score = 58.9 bits (141), Expect = 6e-09 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 7/62 (11%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENR-------WYNFDDSHVSAINEEEVKSGAAYVLFY 304 YAV NHYG M GHYTA +L ++ W FDDS V+ ++E +V + AYVLFY Sbjct: 1205 YAVINHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFY 1264 Query: 303 RR 298 RR Sbjct: 1265 RR 1266
>UBP20_HUMAN (Q9Y2K6) Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.1.2.15)| (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (Deubiquitinating enzyme 20) Length = 913 Score = 58.2 bits (139), Expect = 1e-08 Identities = 23/53 (43%), Positives = 36/53 (67%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 289 H+G+ SGHY AY + + +WY FDD +V+ ++E V++ YVLFYR+ +E Sbjct: 634 HHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSE 686
>UBP2_HUMAN (O75604) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 605 Score = 57.8 bits (138), Expect = 1e-08 Identities = 24/53 (45%), Positives = 35/53 (66%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 YAVSNH G+ GHYTAY + W+ F+DS V+ ++ +V++ AY+LFY Sbjct: 544 YAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFY 596
>UBP2_MOUSE (O88623) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 353 Score = 57.0 bits (136), Expect = 2e-08 Identities = 24/53 (45%), Positives = 35/53 (66%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 YAVSNH G+ GHYTAY + W+ F+DS V+ ++ +V++ AY+LFY Sbjct: 292 YAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVRTSDAYLLFY 344
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 53.9 bits (128), Expect = 2e-07 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVK 331 ++V H GS A GHY A IK + +WY+FDD HVS I +E++K Sbjct: 490 FSVMAHSGSAAGGHYYACIKSFSDEQWYSFDDQHVSRITQEDIK 533
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 53.1 bits (126), Expect = 3e-07 Identities = 25/58 (43%), Positives = 37/58 (63%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 289 YA+ NH GS+ GHYTA + + W+ ++DS VS ++E +V S YVLFY+ + E Sbjct: 506 YALCNHSGSVHYGHYTALCRC--QTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQE 561
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 53.1 bits (126), Expect = 3e-07 Identities = 25/58 (43%), Positives = 37/58 (63%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 289 YA+ NH GS+ GHYTA + + W+ ++DS VS ++E +V S YVLFY+ + E Sbjct: 505 YALCNHSGSVHYGHYTALCRC--QTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQE 560
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 52.8 bits (125), Expect = 4e-07 Identities = 27/53 (50%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = -1 Query: 459 AVSNHYGS-MASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 AV H+GS + SGHYTAY + E RW++F+DS V+ +EE V AY+LFY Sbjct: 458 AVVVHHGSGVGSGHYTAYA--VHEGRWFHFNDSTVTVTDEETVGKAKAYILFY 508
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 52.0 bits (123), Expect = 7e-07 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVK 331 ++V H GS A GHY A IK +++WY+F+D HVS I +E++K Sbjct: 490 FSVMVHSGSAAGGHYYACIKSFSDDQWYSFNDQHVSRITQEDIK 533
>UBPE_DROME (Q24574) Ubiquitin carboxyl-terminal hydrolase 64E (EC 3.1.2.15)| (Ubiquitin thioesterase 64E) (Ubiquitin-specific-processing protease 64E) (Deubiquitinating enzyme 64E) Length = 1556 Score = 51.6 bits (122), Expect = 1e-06 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 17/73 (23%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVK---------------- 331 +A+ H GS + GHY AYIK D N W+ F+D +V++I +E+++ Sbjct: 707 FAIMIHSGSASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRSFGGPNGSYYSSAYT 766 Query: 330 -SGAAYVLFYRRV 295 S AY+L YR+V Sbjct: 767 SSTNAYMLMYRQV 779
>UBPL_MIMIV (Q5UQR3) Probable ubiquitin carboxyl-terminal hydrolase (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin specific-processing protease) (Deubiquitinating enzyme) Length = 468 Score = 51.6 bits (122), Expect = 1e-06 Identities = 19/53 (35%), Positives = 32/53 (60%) Frame = -1 Query: 456 VSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 V NH+G + +GHY Y K+ + WY F+D++ + + + + AY+LFY R Sbjct: 409 VINHHGGLNNGHYFTYSKIENTGEWYEFNDTYTGKVTDNHIVNQNAYILFYIR 461
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 51.6 bits (122), Expect = 1e-06 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = -1 Query: 459 AVSNHYGS-MASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 AV H+GS + SGHYTAY E RW++F+DS V+ +EE V AY+LFY Sbjct: 459 AVVVHHGSGVGSGHYTAYAT--HEGRWFHFNDSTVTLTDEETVVKAKAYILFY 509
>UBP4_YEAST (P32571) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Vacuole biogenesis protein SSV7) Length = 926 Score = 51.2 bits (121), Expect = 1e-06 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAI-NEEEVKSGAAYVLFYRRV 295 Y V+ H+G++ GHYTAY+K + W FDD+ + N+ + + AYVLFY RV Sbjct: 867 YGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNKADAINSNAYVLFYHRV 923
>UBP16_HUMAN (Q9Y5T5) Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.1.2.15)| (Ubiquitin thioesterase 16) (Ubiquitin-specific-processing protease 16) (Deubiquitinating enzyme 16) (Ubiquitin-processing protease UBP-M) Length = 823 Score = 49.7 bits (117), Expect = 4e-06 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 22/78 (28%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDEN----------------------RWYNFDDSHVSAI 349 Y V H G+M SGHYTAY K N +W++ D+HV A+ Sbjct: 745 YGVVEHSGTMRSGHYTAYAKARTANSHLSNLVLHGDIPQDFEMESKGQWFHISDTHVQAV 804 Query: 348 NEEEVKSGAAYVLFYRRV 295 +V + AY+LFY R+ Sbjct: 805 PTTKVLNSQAYLLFYERI 822
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 49.7 bits (117), Expect = 4e-06 Identities = 22/51 (43%), Positives = 35/51 (68%) Frame = -1 Query: 456 VSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 + +H G++ GHY A+ K+ +W+ F+DS VS+I++EEV AY+LFY Sbjct: 416 IVSHKGTVNEGHYIAFCKI-SGGQWFKFNDSMVSSISQEEVLKEQAYLLFY 465
>UBP5_YEAST (P39944) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) Length = 805 Score = 48.9 bits (115), Expect = 6e-06 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAIN-EEEVKSGAAYVLFYRRV 295 Y V+ H GS+ GHYT+Y+ + WY FDDS I E + +AYVLFY R+ Sbjct: 748 YGVACHSGSLYGGHYTSYVYKGPKKGWYFFDDSLYRPITFSTEFITPSAYVLFYERI 804
>UBP51_HUMAN (Q70EK9) Ubiquitin carboxyl-terminal hydrolase 51 (EC 3.1.2.15)| (Ubiquitin thioesterase 51) (Ubiquitin-specific-processing protease 51) (Deubiquitinating enzyme 51) Length = 711 Score = 48.5 bits (114), Expect = 8e-06 Identities = 19/55 (34%), Positives = 38/55 (69%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 +AV NH+G++ SGHYT++I+ +++W++ DD+ ++ E++ Y+LFY + Sbjct: 652 FAVINHHGTLESGHYTSFIR-QQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHK 705
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 47.8 bits (112), Expect = 1e-05 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 YA+S H G + GHY Y K +WY ++DS ++ +E+ + +AY+LFY + Sbjct: 1513 YAISCHSGILGGGHYVTYAKN-PNCKWYCYNDSSCKELHPDEIDTDSAYILFYEQ 1566
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 47.8 bits (112), Expect = 1e-05 Identities = 20/55 (36%), Positives = 34/55 (61%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 YA+S H G ++ GHY Y K +WY ++DS ++ +E+ + +AY+LFY + Sbjct: 1315 YAISCHSGILSGGHYITYAKN-PNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQ 1368
>UBP22_MOUSE (Q5DU02) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 47.4 bits (111), Expect = 2e-05 Identities = 19/55 (34%), Positives = 37/55 (67%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 +AV NH G++ SGHYT++I+ +++W+ DD+ ++ + ++V Y+LFY + Sbjct: 466 FAVVNHQGTLESGHYTSFIR-QHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHK 519
>UBP22_HUMAN (Q9UPT9) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 47.4 bits (111), Expect = 2e-05 Identities = 19/55 (34%), Positives = 37/55 (67%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 +AV NH G++ SGHYT++I+ +++W+ DD+ ++ + ++V Y+LFY + Sbjct: 466 FAVVNHQGTLESGHYTSFIR-QHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHK 519
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 47.0 bits (110), Expect = 2e-05 Identities = 21/53 (39%), Positives = 33/53 (62%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 Y+V H G++ +GHY AY +N+W+ DD+ + + E EV + AY+LFY Sbjct: 382 YSVVCHKGTLDTGHYIAYTYY--QNQWFLLDDTTIVEVKESEVLNSQAYLLFY 432
>UBP2_ARATH (Q8W4N3) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (AtUBP2) Length = 961 Score = 46.6 bits (109), Expect = 3e-05 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 8/59 (13%) Frame = -1 Query: 447 HYGSMASGHYTAYI------KLLDENR--WYNFDDSHVSAINEEEVKSGAAYVLFYRRV 295 H G+M GHY AY+ K D + WYN D++V ++ E+V AY+LFY R+ Sbjct: 899 HSGTMRGGHYVAYVRGGQRVKETDSSSTAWYNVSDAYVRQVSLEKVLHSEAYILFYERI 957
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 45.8 bits (107), Expect = 5e-05 Identities = 27/69 (39%), Positives = 37/69 (53%), Gaps = 13/69 (18%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYI-KLLDEN------RWYNFDDSHVSAINEE------EVKSGA 322 + V NH G++ SGHYT+ + K L+ N +WY FDD V A + ++ S Sbjct: 1001 FGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSD 1060 Query: 321 AYVLFYRRV 295 YVLFY RV Sbjct: 1061 VYVLFYERV 1069
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 45.1 bits (105), Expect = 9e-05 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 9/61 (14%) Frame = -1 Query: 456 VSNHYGSMA-SGHYTAYIK-LLDENRWYNFDDSHVSAINEEEV-------KSGAAYVLFY 304 V H G+ + SGHY A+I+ LDEN+WY F+D VS + +E++ +S +A +L Y Sbjct: 435 VITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSALILMY 494 Query: 303 R 301 + Sbjct: 495 K 495
>UBP44_HUMAN (Q9H0E7) Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.1.2.15)| (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44) (Deubiquitinating enzyme 44) Length = 712 Score = 44.7 bits (104), Expect = 1e-04 Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -1 Query: 459 AVSNHYGS-MASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY-RRVTE 289 AV H+G SGHYTAY + W + +DS +S +EV AY+LFY +RVTE Sbjct: 623 AVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMCTMDEVCKAQAYILFYTQRVTE 681
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 44.3 bits (103), Expect = 2e-04 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 462 YAVSNHYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 295 YAV H G S +GHY Y+K +WY +DS V + N + V + AYVLFY R+ Sbjct: 368 YAVLVHSGYSCHAGHYYCYVKA-SNGQWYQMNDSLVHSSNVKVVLNQQAYVLFYLRI 423
>UBP1_ARATH (Q9FPT5) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) (AtUBP1) Length = 1083 Score = 44.3 bits (103), Expect = 2e-04 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 12/63 (19%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLLDENR------------WYNFDDSHVSAINEEEVKSGAAYVLFY 304 H G+M+ GHY +YI+ + R WY+ DS V + EEV AY+LFY Sbjct: 1021 HLGAMSRGHYVSYIRGGHKERRDSDTKEPNSSIWYHASDSQVRPASLEEVLRSEAYILFY 1080 Query: 303 RRV 295 R+ Sbjct: 1081 ERI 1083
>UBP49_MOUSE (Q6P9L4) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 685 Score = 43.9 bits (102), Expect = 2e-04 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -1 Query: 459 AVSNHYGS-MASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVT 292 AV H+G SGHYTAY + W + +DS + + EEV AY+LFY R T Sbjct: 599 AVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLDVCSVEEVCKTQAYILFYTRRT 655
>UBP10_MOUSE (P52479) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 792 Score = 43.1 bits (100), Expect = 3e-04 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = -1 Query: 462 YAVSNHYGSMA-SGHYTAYIKLLDENRWYNFDDSHVSAINEEEV----KSGAAYVLFYRR 298 +AV H+G+ A GHYT + + N W DD V IN+ +V AY+L+YRR Sbjct: 729 FAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPPADRTAYLLYYRR 788 Query: 297 V 295 V Sbjct: 789 V 789
>UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 798 Score = 43.1 bits (100), Expect = 3e-04 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = -1 Query: 462 YAVSNHYGSMA-SGHYTAYIKLLDENRWYNFDDSHVSAINEEEV----KSGAAYVLFYRR 298 +AV H+G+ A GHYT + + N W DD V IN+ +V AY+L+YRR Sbjct: 735 FAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRR 794 Query: 297 V 295 V Sbjct: 795 V 795
>UBP49_HUMAN (Q70CQ1) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 688 Score = 43.1 bits (100), Expect = 3e-04 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = -1 Query: 459 AVSNHYGS-MASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTEAD 283 AV H+G SGHYTAY + W + +DS ++ + EEV AY+LFY + T Sbjct: 602 AVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQG 661 Query: 282 GAASNGT 262 A + T Sbjct: 662 NARISET 668
>UBP3_SCHPO (O94269) Probable ubiquitin carboxyl-terminal hydrolase 3 (EC| 3.1.2.15) (Ubiquitin thioesterase 3) (Ubiquitin-specific processing protease 3) (Deubiquitinating enzyme 3) Length = 512 Score = 42.7 bits (99), Expect = 4e-04 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 17/71 (23%) Frame = -1 Query: 459 AVSNHYGSMASG-HYTAYIKLLDENRWYNFDDSHVSAINEEEVKSG-------------- 325 AV H+G+ ASG HYT ++ LD++ W+ DD+H+ + +V++ Sbjct: 440 AVVYHHGTSASGGHYTVDVQQLDKSGWFRIDDTHIHRVPIHDVENSELSADPSLSKLGHG 499 Query: 324 --AAYVLFYRR 298 AY+LFY R Sbjct: 500 DRVAYLLFYTR 510
>UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.1.2.15)| (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Deubiquitinating enzyme 30) Length = 517 Score = 42.4 bits (98), Expect = 6e-04 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = -1 Query: 459 AVSNHYGSMASGHYTAYIK--------LLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 AV H+G M SGH+ Y + L N+W D V + +EV S +AY+LFY Sbjct: 440 AVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFY 499 Query: 303 RRV 295 RV Sbjct: 500 ERV 502
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 41.6 bits (96), Expect = 0.001 Identities = 26/56 (46%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -1 Query: 462 YAVSNHYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 YAV H G + +GHY YIK WY +DS VS + V S AYVLFY R Sbjct: 357 YAVLVHTGFNCHAGHYFCYIKA-SNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIR 411
>UBP11_YEAST (P36026) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 717 Score = 41.2 bits (95), Expect = 0.001 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 16/74 (21%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKL-------LDENRWYNFDDSHVSAINEE---------EVK 331 Y NH G++ +GHYT+ + L+ W FDD ++ ++ E+ Sbjct: 636 YGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMS 695 Query: 330 SGAAYVLFYRRVTE 289 S YVLFY R+ E Sbjct: 696 SDEVYVLFYERMDE 709
>UBP14_CAEEL (Q17361) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 489 Score = 41.2 bits (95), Expect = 0.001 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 8/59 (13%) Frame = -1 Query: 456 VSNHYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV--KSG-----AAYVLFY 304 + H G S GHY A+++ ++ +W FDD HV+ ++EE + SG +AYVL Y Sbjct: 397 IITHKGRSSQDGHYVAWMRSSEDGKWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLY 455
>UBP3_YEAST (Q01477) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 912 Score = 41.2 bits (95), Expect = 0.001 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 9/59 (15%) Frame = -1 Query: 447 HYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSG--------AAYVLFYRR 298 H+G S GHYTA + + N+WY DD +++ + +++V G AY+L Y++ Sbjct: 852 HHGVSSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLKGGEEASDSRTAYILMYQK 910
>UBP18_HUMAN (Q9UMW8) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) (hUBP43) Length = 372 Score = 40.4 bits (93), Expect = 0.002 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 10/66 (15%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVK----------SGAAYV 313 +AV H G SGHY YI+ + +W+ F+DS++ ++ E+++ AY+ Sbjct: 305 FAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQETAYL 364 Query: 312 LFYRRV 295 L Y ++ Sbjct: 365 LVYMKM 370
>UBP18_MOUSE (Q9WTV6) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) Length = 368 Score = 39.3 bits (90), Expect = 0.005 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVK 331 +AV H G GHY AYI+ + +W+ F+DSHV + ++V+ Sbjct: 301 FAVIAHVGMADFGHYCAYIRNPVDGKWFCFNDSHVCWVTWKDVQ 344
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 38.9 bits (89), Expect = 0.006 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -1 Query: 462 YAVSNHYGSMA-SGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFY 304 YAV H G+ + SGHY +K +WY DD+ V+ + V + AYVLFY Sbjct: 293 YAVLVHDGATSHSGHYFCCVKA-GHGKWYKMDDTKVTRCDVTSVLNENAYVLFY 345
>UBP14_HUMAN (P54578) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 493 Score = 38.1 bits (87), Expect = 0.011 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 10/65 (15%) Frame = -1 Query: 459 AVSNHYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV--KSGA-----AYVLFY 304 AV H G S +SGHY +++K ++ W FDD VS + E++ SG AYVL Y Sbjct: 421 AVLTHQGRSSSSGHYVSWVKR-KQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY 479 Query: 303 --RRV 295 RRV Sbjct: 480 GPRRV 484
>UBP4_SCHPO (O60139) Probable ubiquitin carboxyl-terminal hydrolase 4 (EC| 3.1.2.15) (Ubiquitin thioesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) Length = 438 Score = 38.1 bits (87), Expect = 0.011 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDS---HVSAINEEEVKSGAAYVLFYRR 298 +A HYG + +GHY + +L N W + DDS V I + ++Y+LFY+R Sbjct: 362 FAFICHYGQLENGHYIS--DVLFNNEWCHIDDSIVRTVGGITDLREDFSSSYILFYKR 417
>UBP15_YEAST (P50101) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 1230 Score = 38.1 bits (87), Expect = 0.011 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV 334 + V H G +++GHY IK E++WY FDD V + +++V Sbjct: 452 HGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQV 494
>UBP14_PANTR (P60051) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 38.1 bits (87), Expect = 0.011 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 10/65 (15%) Frame = -1 Query: 459 AVSNHYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV--KSGA-----AYVLFY 304 AV H G S +SGHY +++K ++ W FDD VS + E++ SG AYVL Y Sbjct: 421 AVLTHQGRSSSSGHYVSWVKR-KQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY 479 Query: 303 --RRV 295 RRV Sbjct: 480 GPRRV 484
>UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrolase 5 (EC| 3.1.2.15) (Ubiquitin thioesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) Length = 1108 Score = 37.7 bits (86), Expect = 0.014 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV 334 Y V H G + +GHY A +K + WY +DD+ V+ EV Sbjct: 451 YGVLVHSGDLHNGHYYALLKTEKDGPWYKYDDTRVTRATLREV 493
>UBP7_SCHPO (Q9P7S5) Probable ubiquitin carboxyl-terminal hydrolase 7 (EC| 3.1.2.15) (Ubiquitin thioesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) Length = 875 Score = 37.4 bits (85), Expect = 0.019 Identities = 25/77 (32%), Positives = 33/77 (42%), Gaps = 21/77 (27%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYI---KLLD------------------ENRWYNFDDSHVSAIN 346 + V H G++ GHY AY+ K LD E RW D+ V + Sbjct: 799 FGVIVHSGTLNYGHYVAYVLSHKFLDLSAPSTNSKDFRSEAGIPERRWLYISDNIVRESS 858 Query: 345 EEEVKSGAAYVLFYRRV 295 +EV AY+LFY RV Sbjct: 859 WDEVSKVEAYMLFYERV 875
>UBP14_RABIT (P40826) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 37.4 bits (85), Expect = 0.019 Identities = 27/65 (41%), Positives = 35/65 (53%), Gaps = 10/65 (15%) Frame = -1 Query: 459 AVSNHYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV--KSGA-----AYVLFY 304 AV H G S +SGHY +++K + W FDD VS + E++ SG AYVL Y Sbjct: 420 AVLTHQGRSSSSGHYVSWVKR-KHDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY 478 Query: 303 --RRV 295 RRV Sbjct: 479 GPRRV 483
>UBP14_MOUSE (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 37.0 bits (84), Expect = 0.025 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 10/65 (15%) Frame = -1 Query: 459 AVSNHYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV--KSGA-----AYVLFY 304 AV H G S +SGHY ++++ ++ W FDD VS + E++ SG AYVL Y Sbjct: 420 AVLTHQGRSSSSGHYVSWVRR-KQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY 478 Query: 303 --RRV 295 RRV Sbjct: 479 GPRRV 483
>UBP37_HUMAN (Q86T82) Ubiquitin carboxyl-terminal hydrolase 37 (EC 3.1.2.15)| (Ubiquitin thioesterase 37) (Ubiquitin-specific-processing protease 37) (Deubiquitinating enzyme 37) Length = 979 Score = 36.6 bits (83), Expect = 0.032 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = -1 Query: 459 AVSNHYGSMAS-GHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSG---AAYVLFY 304 +V +H GS +S GHY + + + + W+ ++D VS I E V+S + Y+ FY Sbjct: 893 SVVSHIGSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYIFFY 948
>UBPA_DICDI (P54201) Ubiquitin carboxyl-terminal hydrolase A (EC 3.1.2.15)| (Ubiquitin thioesterase A) (Ubiquitin-specific-processing protease A) (Deubiquitinating enzyme A) Length = 837 Score = 36.2 bits (82), Expect = 0.042 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -1 Query: 450 NHYGS-MASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 +H G+ + GHY +IK NRW F+D HV E+ Y+ FY+R Sbjct: 787 SHLGNNVTCGHYVCHIK--KNNRWIKFNDRHVQL--SEQPPKELGYIYFYKR 834
>UBP2_YEAST (Q01476) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) Length = 1272 Score = 36.2 bits (82), Expect = 0.042 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENR---WYNFDDSHVSAINEEEV 334 ++V H G + GHY YIK D NR W ++D +S + EEEV Sbjct: 1196 FSVFIHRGEASYGHYWIYIK--DRNRNGIWRKYNDETISEVQEEEV 1239
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 36.2 bits (82), Expect = 0.042 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEE 337 +AV H G GHY Y+ + +W FDD VS +EE Sbjct: 451 HAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEE 492
>UBP25_MOUSE (P57080) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (mUSP25) Length = 1055 Score = 35.8 bits (81), Expect = 0.055 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 8/61 (13%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV--------KSGAAYVLF 307 +AV H G +GHY AYI E+RW ++D V+ + EE+ ++ +AY L Sbjct: 595 HAVLVHEGQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLM 654 Query: 306 Y 304 Y Sbjct: 655 Y 655
>UBP6_SCHPO (Q92353) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thiolesterase 6) (Ubiquitin-specific processing protease 6) (Deubiquitinating enzyme 6) Length = 467 Score = 35.8 bits (81), Expect = 0.055 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 9/61 (14%) Frame = -1 Query: 456 VSNHYGSMAS-GHYTAYIKLLDEN-RWYNFDDSHVSAINEEEV-------KSGAAYVLFY 304 V +H G+ AS GHY A+I+ + W+ F+D+ VS + E++ ++ +AY+L Y Sbjct: 402 VLSHAGASASSGHYQAWIRNSNNRAEWFRFNDAKVSIVPAEKIETLDGGGEADSAYILLY 461 Query: 303 R 301 + Sbjct: 462 K 462
>UBP25_HUMAN (Q9UHP3) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (USP on chromosome 21) Length = 1087 Score = 35.8 bits (81), Expect = 0.055 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 8/61 (13%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV--------KSGAAYVLF 307 +AV H G +GHY AYI E+RW ++D V+ + EE+ ++ +AY L Sbjct: 594 HAVLVHEGQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLM 653 Query: 306 Y 304 Y Sbjct: 654 Y 654
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 35.8 bits (81), Expect = 0.055 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV 334 + V H G + GHY A IK ++ W+ FDD V+ +EV Sbjct: 468 HGVLVHGGDLHGGHYYALIKPEKDSNWFKFDDDRVTRATIKEV 510
>USP9X_MOUSE (P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein-related, X-linked) (Ubiquitin-specif Length = 2559 Score = 34.7 bits (78), Expect = 0.12 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 8/48 (16%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLL-----DENRWYNFDDSHVSAI---NEEEVKS 328 H G + GHY +YI ++NRWY FDD V+ ++EE+K+ Sbjct: 1871 HSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKT 1918
>UBP2_SCHPO (Q9P3U0) Probable ubiquitin carboxyl-terminal hydrolase 2 (EC| 3.1.2.15) (Ubiquitin thioesterase 2) (Ubiquitin-specific processing protease 2) (Deubiquitinating enzyme 2) Length = 1141 Score = 34.3 bits (77), Expect = 0.16 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -1 Query: 459 AVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV 334 AV H G + GHY YI + N + ++D +V+ ++E E+ Sbjct: 1064 AVFVHRGQASFGHYWTYIHDFENNVYRKYNDEYVTVVDESEI 1105
>USP9X_HUMAN (Q93008) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specif Length = 2547 Score = 34.3 bits (77), Expect = 0.16 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 8/48 (16%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLL-----DENRWYNFDDSHVSAI---NEEEVKS 328 H G + GHY +YI + NRWY FDD V+ ++EE+K+ Sbjct: 1864 HSGQASGGHYYSYIIQRNGGDGERNRWYKFDDGDVTECKMDDDEEMKN 1911
>UBP29_HUMAN (Q9HBJ7) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 922 Score = 34.3 bits (77), Expect = 0.16 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = -1 Query: 459 AVSNHYGSMA-SGHYTAYIKLLDENRWYNFDDSHVSAINE---EEVKSGAAYVLFY 304 +V +H GS SGHY + + + W+ ++D VS I+E +E + + Y+ FY Sbjct: 827 SVVSHIGSSPNSGHYISDVYDFQKQAWFTYNDLCVSEISETKMQEARLHSGYIFFY 882
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 33.1 bits (74), Expect = 0.36 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 13/66 (19%) Frame = -1 Query: 462 YAVSNHYGSMAS-GHYTAYIKLLDENRWYNFDDSHVSAINEEEVK------------SGA 322 +AV H GS + GHY + +K N W FDD +V I E V+ + Sbjct: 301 FAVVVHVGSGPNHGHYVSLVK--SHNHWLFFDDENVEMIEESAVQTFFGSSQEYSSNTDH 358 Query: 321 AYVLFY 304 Y+LFY Sbjct: 359 GYILFY 364
>UBP14_ARATH (Q8L6Y1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (AtUBP14) (TITAN-6 protein) Length = 797 Score = 33.1 bits (74), Expect = 0.36 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -1 Query: 462 YAVSNHYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 295 + + +H G S+ GHY A+I L E RW F+D V + G YV F++R+ Sbjct: 744 FGIVSHMGTSVHCGHYVAHI--LKEGRWVIFNDDKVGISTDPPKDMG--YVYFFQRL 796
>UBP28_MOUSE (Q5I043) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1051 Score = 33.1 bits (74), Expect = 0.36 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 8/61 (13%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEE--------VKSGAAYVLF 307 +AV H G ++GHY AYI W ++D V+ + EE +++ +AY L Sbjct: 592 HAVLVHEGQASAGHYWAYIYNQPRQTWLKYNDISVTESSWEELERDSYGGLRNVSAYCLM 651 Query: 306 Y 304 Y Sbjct: 652 Y 652
>UBP28_HUMAN (Q96RU2) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1077 Score = 33.1 bits (74), Expect = 0.36 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 8/61 (13%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEV--------KSGAAYVLF 307 +AV H G +GHY AYI W ++D V+ + EEV ++ +AY L Sbjct: 587 HAVLVHEGQANAGHYWAYIYNQPRQSWLKYNDISVTESSWEEVERDSYGGLRNVSAYCLM 646 Query: 306 Y 304 Y Sbjct: 647 Y 647
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 33.1 bits (74), Expect = 0.36 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 8/65 (12%) Frame = -1 Query: 441 GSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVK--------SGAAYVLFYRRVTEA 286 G GHY + ++ W FDD +V+ +NE ++ AYVLFY E Sbjct: 369 GGPHRGHYVSIVRTKTYG-WVLFDDENVTPVNENYLQRFFGDQPGQATAYVLFYTAADEE 427 Query: 285 DGAAS 271 D S Sbjct: 428 DDDVS 432
>UBP14_YEAST (P38237) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (Glucose-induced degradation protein 6) Length = 803 Score = 33.1 bits (74), Expect = 0.36 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 5/59 (8%) Frame = -1 Query: 459 AVSNHYG-SMASGHYTAYIKLLDENRW----YNFDDSHVSAINEEEVKSGAAYVLFYRR 298 AV H G S+ SGHY +I+ L ++W YN D+ V+A + E++K Y+ FY R Sbjct: 746 AVICHKGNSVHSGHYVVFIRKLVADKWKWVLYN-DEKLVAADSIEDMKKN-GYIYFYTR 802
>UBP11_SCHPO (Q9UUD6) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 350 Score = 32.7 bits (73), Expect = 0.46 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLLDENRWYNFDDSHV--SAINEEEVKSGAAYVLFY 304 H GS+ GHY Y L ++ W+ +DS + S++NE ++ +A +LFY Sbjct: 294 HSGSVTYGHYLCY--RLQDDIWWKANDSLITKSSLNEALSQTRSACLLFY 341
>UBP1_YEAST (P25037) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) Length = 809 Score = 32.7 bits (73), Expect = 0.46 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKS-GAAYVLFY 304 HYG+ GHY A+ K W+ D V ++E EV S ++LFY Sbjct: 689 HYGTHNYGHYIAFRKY--RGCWWRISDETVYVVDEAEVLSTPGVFMLFY 735
>UBP35_HUMAN (Q9P2H5) Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)| (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35) (Deubiquitinating enzyme 35) Length = 1017 Score = 32.3 bits (72), Expect = 0.61 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 7/39 (17%) Frame = -1 Query: 393 ENRWYNFDDSHVSAINEEEVKS-------GAAYVLFYRR 298 EN+WY F+D+ VS + E V + AYVLFYR+ Sbjct: 886 ENQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYRQ 924
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 32.0 bits (71), Expect = 0.79 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 462 YAVSNHYGSMAS-GHYTAYIKLLDENRWYNFDDSHVSAINEEEVKS 328 +AV H GS + GHY + +K N W FDD V I E V++ Sbjct: 296 FAVVVHVGSGPNHGHYVSLVK--SHNHWLFFDDESVEIIEESAVQT 339
>UBP2_KLULA (O42726) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) Length = 1220 Score = 32.0 bits (71), Expect = 0.79 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 7/62 (11%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENR-WYNFDDSHVSAINEEEV------KSGAAYVLFY 304 +AV H G + GHY YIK +N W ++D V+ + + EV + Y L Y Sbjct: 1140 FAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTATPYFLVY 1199 Query: 303 RR 298 R Sbjct: 1200 VR 1201
>UBP26_HUMAN (Q9BXU7) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 913 Score = 32.0 bits (71), Expect = 0.79 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = -1 Query: 459 AVSNHYG-SMASGHYTAYIKLLDENRWYNFDDSHVSAINE---EEVKSGAAYVLFY 304 +V +H G ++ SGHY ++ W+ +DD V I E +E + Y+ FY Sbjct: 828 SVVSHLGKTLKSGHYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRRCTGYIFFY 883
>UBP26_MOUSE (Q99MX1) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 835 Score = 31.6 bits (70), Expect = 1.0 Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 4/71 (5%) Frame = -1 Query: 456 VSNHYGSMASG-HYTAYIKLLDENRWYNFDDSHVSAINEEEV---KSGAAYVLFYRRVTE 289 + NH G+ +G HY W+ + D HV+ E+ V +S YV FY Sbjct: 759 IINHIGNSPNGGHYINDAFDFKRQSWFTYSDLHVTRTQEDFVYRGRSSTGYVFFYMHNDI 818 Query: 288 ADGAASNGTQS 256 + + TQS Sbjct: 819 FEELLAKETQS 829
>UBP28_CHICK (Q5ZID5) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1047 Score = 31.2 bits (69), Expect = 1.3 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 8/61 (13%) Frame = -1 Query: 462 YAVSNHYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEE--------VKSGAAYVLF 307 +AV H G +GHY A+I W ++D V+ + EE +++ +AY L Sbjct: 588 HAVLVHEGQANAGHYWAFIYDQPRKSWLKYNDISVTESSWEELERDSFGGLRNASAYCLM 647 Query: 306 Y 304 Y Sbjct: 648 Y 648
>FAF_DROME (P55824) Probable ubiquitin carboxyl-terminal hydrolase FAF (EC| 3.1.2.15) (Ubiquitin thioesterase FAF) (Ubiquitin specific-processing protease FAF) (Deubiquitinating enzyme FAF) (Protein fat facets) Length = 2778 Score = 31.2 bits (69), Expect = 1.3 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 9/49 (18%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLLDEN------RWYNFDDSHVSAI---NEEEVKS 328 H G + GHY +YI L +N +WY FDD V+ +EE+K+ Sbjct: 1978 HSGQASGGHYFSYI--LSKNPANGKCQWYKFDDGEVTECKMHEDEEMKA 2024
>USP9Y_HUMAN (O00507) Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-Y) (Ubiquitin-specific-processing protease FAF-Y) (Deubiquitinating enzyme FAF-Y) (Fat facets protein-related, Y-linked) (Ubiquitin-specif Length = 2555 Score = 30.8 bits (68), Expect = 1.8 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 8/48 (16%) Frame = -1 Query: 447 HYGSMASGHYTAYI-----KLLDENRWYNFDDSHVSAI---NEEEVKS 328 H G + GHY +YI K + WY FDD V+ ++EE+K+ Sbjct: 1873 HSGQASGGHYYSYIIQRNGKDDQTDHWYKFDDGDVTECKMDDDEEMKN 1920
>UBP40_MOUSE (Q8BWR4) Ubiquitin carboxyl-terminal hydrolase 40 (EC 3.1.2.15)| (Ubiquitin thioesterase 40) (Ubiquitin-specific-processing protease 40) (Deubiquitinating enzyme 40) (Fragment) Length = 1140 Score = 29.6 bits (65), Expect = 3.9 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 5/36 (13%) Frame = -1 Query: 384 WYNFDDSHVSAINEEEVKSG-----AAYVLFYRRVT 292 W++ +DS V I E+++ +AY+LFYR+ T Sbjct: 448 WFDINDSKVHPIREKDITQQFQGKESAYMLFYRKAT 483
>YAA4_SCHPO (Q09798) Hypothetical protein C22G7.04 in chromosome I| Length = 1115 Score = 28.9 bits (63), Expect = 6.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 396 DENRWYNFDDSHVSAINEEE 337 D+NRWY F+D V + EEE Sbjct: 803 DDNRWYIFNDFLVKEVTEEE 822
>NPW_PIG (Q8MI35) Neuropeptide W precursor (Preproprotein L8) (PPL8)| [Contains: Neuropeptide W-23 (NPW23) (L8); Neuropeptide W-30 (NPW30) (L8C)] Length = 152 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 75 LLIVFLTPFPSKLYSRNILWSHTETLQFHTQKGTKGVLLKLRR 203 LL++ L P P++ + + HT + ++HT G+L+ LRR Sbjct: 20 LLLLLLLPLPARAW-----YKHTASPRYHTVGRAAGLLMGLRR 57
>CA036_HUMAN (Q7Z3Z2) Protein C1orf36| Length = 195 Score = 28.9 bits (63), Expect = 6.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 167 KRNQRGSSKIAKVCNNSDYLWLDLRLRFTHDWVPL 271 ++ + S+ + KVC DY WL R T+D P+ Sbjct: 42 RQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPI 76
>SNUT2_PONPY (Q5R761) U4/U6.U5 tri-snRNP-associated protein 2 (Inactive| ubiquitin-specific peptidase 39) Length = 565 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 H G + G Y ++ +WY D V+ I + + AY+ ++R Sbjct: 505 HDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKR 554
>SNUT2_MOUSE (Q3TIX9) U4/U6.U5 tri-snRNP-associated protein 2 (Inactive| ubiquitin-specific peptidase 39) Length = 564 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 H G + G Y ++ +WY D V+ I + + AY+ ++R Sbjct: 504 HDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKR 553
>SNUT2_HUMAN (Q53GS9) U4/U6.U5 tri-snRNP-associated protein 2 (U4/U6.U5| tri-snRNP-associated 65 kDa protein) (65K) (Inactive ubiquitin-specific peptidase 39) (SAD1 homolog) Length = 565 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = -1 Query: 447 HYGSMASGHYTAYIKLLDENRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 298 H G + G Y ++ +WY D V+ I + + AY+ ++R Sbjct: 505 HDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKR 554 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,786,399 Number of Sequences: 219361 Number of extensions: 1379729 Number of successful extensions: 4338 Number of sequences better than 10.0: 100 Number of HSP's better than 10.0 without gapping: 4225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4310 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)