Clone Name | rbastl05b10 |
---|---|
Clone Library Name | barley_pub |
>CDK7_MOUSE (Q03147) Cell division protein kinase 7 (EC 2.7.11.22) (EC| 2.7.11.23) (CDK-activating kinase) (CAK) (TFIIH basal transcription factor complex kinase subunit) (39 kDa protein kinase) (P39 Mo15) (Protein-tyrosine kinase MPK-7) (CR4 protein kinas Length = 346 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 6/36 (16%) Frame = +1 Query: 73 EDLFKMNTCFITT------TKLPPSRPAPTPGMEMP 162 + LF N C TT TK +RP PTPG ++P Sbjct: 273 QGLFLFNPCTRTTASQALKTKYFSNRPGPTPGCQLP 308
>RGS6_CAEEL (Q18563) Regulator of G-protein signaling rgs-6| Length = 737 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +3 Query: 78 FVQNEHMFHNHNQTPPKSTCAHARHGNASFIFGLFIRPQHNEQTLD 215 F+ F N TP K C ARH S G +RP ++ TLD Sbjct: 329 FLPANFSFKNPASTPTKLVCIRARH---SLSTGAVLRPLLHKYTLD 371
>AP1M_DISOM (P47795) AP-1 complex subunit mu (Clathrin coat assembly protein| AP47 homolog) (Clathrin coat-associated protein AP47 homolog) (Golgi adaptor AP-1 47 kDa protein homolog) (HA1 47 kDa subunit homolog) (Clathrin assembly protein assembly protein Length = 418 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 271 HTLFDLDGGMAVLLVPPWTSRVCSLCCGLMNKPKIKLAFP 152 H+LF ++GG AV L W S V C + + ++K P Sbjct: 3 HSLFLMNGGGAVFLEKHWRSVVSRSVCAYLLEAQLKAGQP 42
>GLT1_SCHPO (Q9C102) Putative glutamate synthase [NADPH] (EC 1.4.1.13)| (NADPH-GOGAT) Length = 2111 Score = 28.1 bits (61), Expect = 6.0 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -3 Query: 262 FDLDGGMAVLL--VPPWTSRVCSLCCGLMNKPKIKL-AFPCLAWAQVDLGG 119 FD D A+ + V PWT V C G M+ I + + LA A LGG Sbjct: 920 FDFDSSQAIPIEQVEPWTEIVRRFCTGAMSYGSISMESHSSLAIAMNRLGG 970
>XTH32_ARATH (Q9SJL9) Probable xyloglucan endotransglucosylase/hydrolase protein| 32 precursor (EC 2.4.1.207) (At-XTH32) (XTH-32) Length = 299 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -2 Query: 281 NAATYPLRPRWRHGSLVSA 225 +A+T+PLRP W +GS+ A Sbjct: 193 SASTFPLRPMWLYGSIWDA 211 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,992,367 Number of Sequences: 219361 Number of extensions: 997988 Number of successful extensions: 2934 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2929 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)