Clone Name | rbastl05b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PGAM2_MOUSE (O70250) Phosphoglycerate mutase 2 (EC 5.4.2.1) (EC ... | 28 | 6.8 |
---|
>PGAM2_MOUSE (O70250) Phosphoglycerate mutase 2 (EC 5.4.2.1) (EC 5.4.2.4) (EC| 3.1.3.13) (Phosphoglycerate mutase isozyme M) (PGAM-M) (BPG-dependent PGAM 2) (Muscle-specific phosphoglycerate mutase) Length = 252 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = -3 Query: 383 FNMHPPTGIQFGDYQTELRKALCRA*LGRYRFLSCE*LGQNIMRAVIFW*GQMRPRV 213 F+ PP + +Y T + K A L +CE L I RA+ FW ++ P++ Sbjct: 118 FDTPPPPMDEKHNYYTSISKDRRYAGLKPEELPTCESLKDTIARALPFWNEEIAPKI 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,191,422 Number of Sequences: 219361 Number of extensions: 782656 Number of successful extensions: 1365 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1365 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)