Clone Name | rbastl05b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | JHD3C_MOUSE (Q8VCD7) JmjC domain-containing histone demethylatio... | 28 | 5.4 | 2 | ADO1_ARATH (Q94BT6) Adagio protein 1 (Protein ZEITLUPE) (LOV kel... | 28 | 7.1 | 3 | DNAJ2_PROAC (Q6A662) Chaperone protein dnaJ 2 | 27 | 9.3 |
---|
>JHD3C_MOUSE (Q8VCD7) JmjC domain-containing histone demethylation protein 3C| (EC 1.14.11.-) (Jumonji domain-containing protein 2C) Length = 1054 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 358 EFLRECLDLDDEVRETASWTQGMIN 284 E L E L +D+EV ET SW + +I+ Sbjct: 593 EELPEVLSIDEEVEETESWAKPLIH 617
>ADO1_ARATH (Q94BT6) Adagio protein 1 (Protein ZEITLUPE) (LOV kelch protein 1)| (Flavin-binding kelch repeat F-box protein 1-like protein 2) (FKF1-like protein 2) (F-box only protein 2b) (FBX2b) (Clock-associated PAS protein ZTL) Length = 609 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -3 Query: 250 TLSCYGGCLVLLMHQTEFGFGSYEQKGTKVYVASVSQ*EPCRRCL 116 TLS YGG +L+ G + + + V+ +S+ EPC RC+ Sbjct: 454 TLSVYGGRKILMFGGLAKS-GPLKFRSSDVFTMDLSEEEPCWRCV 497
>DNAJ2_PROAC (Q6A662) Chaperone protein dnaJ 2| Length = 380 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 172 GTKVYVASVSQ*EPCRRCLGWFYYFQSVKSLCVTFDGSGVY 50 GT V + VSQ PC+ C G +V +C T GSG++ Sbjct: 151 GTTVTMDMVSQ-APCQACRGTGARAGTVPRVCSTCQGSGMH 190 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,843,342 Number of Sequences: 219361 Number of extensions: 1006220 Number of successful extensions: 2057 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2057 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)