ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl05a11 |
|---|---|
| Clone Library Name | barley_pub |
>CARB_ANASP (Q8YQL2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1104 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/37 (54%), Positives = 31/37 (83%) Frame = -3 Query: 349 LAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDY 239 LAYK+PIITT+ GA+AT+ AI+SM+N ++ + +Q+Y Sbjct: 1064 LAYKIPIITTIAGAKATVAAIRSMQNTTLDVKTIQEY 1100
>CARB_SYNY3 (Q55756) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1081 Score = 44.3 bits (103), Expect = 7e-05 Identities = 19/38 (50%), Positives = 30/38 (78%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDY 239 AL YK+PIITT+ G +AT+ A++S+++ + + ALQDY Sbjct: 1042 ALDYKLPIITTIAGGKATVAALRSLQDHPLDVKALQDY 1079
>CARB_RHILO (Q98I87) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1167 Score = 36.6 bits (83), Expect = 0.015 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -3 Query: 349 LAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDYF 236 L KVP TT+ GA A +AI ++K S+++ LQ+YF Sbjct: 1129 LMQKVPYYTTLSGAAAVAEAIAALKAGSLEVRPLQEYF 1166
>CARB_BRUSU (Q8FZJ3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1162 Score = 35.4 bits (80), Expect = 0.033 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -3 Query: 349 LAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDYF 236 L K+P TT+ GA + +AI ++K S+++ LQDYF Sbjct: 1123 LMQKLPYYTTMAGAESAAEAIAALKAGSLEVRPLQDYF 1160
>CARB_BRUME (Q8YIC2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1162 Score = 35.4 bits (80), Expect = 0.033 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -3 Query: 349 LAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDYF 236 L K+P TT+ GA + +AI ++K S+++ LQDYF Sbjct: 1123 LMQKLPYYTTMAGAESAAEAIAALKAGSLEVRPLQDYF 1160
>CARB2_METKA (Q8TUT7) Carbamoyl-phosphate synthase large chain, C-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 542 Score = 35.4 bits (80), Expect = 0.033 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSIKILALQD 242 A+ +KVP ITT+ A+A ++AI+ +K K + + L D Sbjct: 485 AVKFKVPYITTIAAAKAAVEAIELVKEKGVTVNCLHD 521
>CARB_AGRT5 (Q8UDE9) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1162 Score = 34.3 bits (77), Expect = 0.073 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = -3 Query: 349 LAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDYF 236 L KVP TT+ GA A AIK++K ++++ LQ YF Sbjct: 1124 LMQKVPYYTTMAGAEAAALAIKALKAGNLEVKPLQSYF 1161
>CARB_RHIME (Q92PZ4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1163 Score = 34.3 bits (77), Expect = 0.073 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = -3 Query: 349 LAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDYF 236 L KVP TT+ GA A AIK++K ++++ LQ YF Sbjct: 1124 LMQKVPYYTTMAGAEAAALAIKALKAGNLEVRPLQSYF 1161
>CARB_LEPIN (Q8F832) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1106 Score = 33.5 bits (75), Expect = 0.12 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSIKILALQD 242 A+ +KVP +TT + A+A + + MKNK I +LQ+ Sbjct: 1062 AIRFKVPCLTTSNAAKALIKGMVEMKNKGFTIHSLQE 1098
>CARB_LEPIC (Q72NF1) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1106 Score = 33.5 bits (75), Expect = 0.12 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSIKILALQD 242 A+ +KVP +TT + A+A + + MKNK I +LQ+ Sbjct: 1062 AIRFKVPCLTTSNAAKALIKGMVEMKNKGFTIHSLQE 1098
>CARB_THEMA (Q9WZ27) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 32.3 bits (72), Expect = 0.28 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSI-KILALQD 242 AL K+P +TTV+ RA + AI+ MK SI K+ L D Sbjct: 1058 ALKRKIPYLTTVESLRAAVAAIRKMKKGSIVKVRRLTD 1095
>CARB_METMA (P58944) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1073 Score = 32.3 bits (72), Expect = 0.28 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSM-KNKSIKILALQDY 239 A+ +KVP ITT+ A A DAI++M K + + I ++ +Y Sbjct: 1026 AVDFKVPYITTIQAAVAAADAIETMKKGQDLTIKSINEY 1064
>CARB_METTH (O27077) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1060 Score = 32.0 bits (71), Expect = 0.36 Identities = 13/38 (34%), Positives = 26/38 (68%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDY 239 A+ +P +TT+ GARA ++AI++++ I + +L +Y Sbjct: 1020 AVELGIPYVTTLAGARAALNAIEAVRMGKITVKSLDEY 1057
>CARB_ARCFU (O28994) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 31.2 bits (69), Expect = 0.62 Identities = 14/38 (36%), Positives = 27/38 (71%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDY 239 A+ Y V ITT+ GA A + AI+++K++ + + ++Q+Y Sbjct: 1035 AVDYGVAHITTLAGAMAAVRAIEAVKSRKMVVKSIQEY 1072
>CARB_CORGL (P58939) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1113 Score = 30.8 bits (68), Expect = 0.80 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSIKILALQD 242 A+ VP+ITTV G A + I++++ + + ALQ+ Sbjct: 1070 AVTVGVPLITTVQGVTAAVQGIEALREGVVSVRALQE 1106
>CARB2_METJA (Q58776) Carbamoyl-phosphate synthase large chain, C-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 618 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = -3 Query: 337 VPIITTVDGARATMDAIKSMKNKSIKILALQD 242 +P ITT+ GA+A + AI+++K + + +L + Sbjct: 578 IPYITTIPGAKAAVKAIEAVKTGELSVYSLDE 609
>CARB_METAC (Q8TNY4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1070 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSM-KNKSIKILALQDY 239 A+ +KVP ITT+ A A AI++M K + + I ++ +Y Sbjct: 1026 AVDFKVPYITTIQAASAAAAAIETMKKGEDLTIKSINEY 1064
>NUCM_TRYBB (P21301) NADH-ubiquinone oxidoreductase 49 kDa subunit homolog (EC| 1.6.5.3) (NADH dehydrogenase subunit 7 homolog) Length = 386 Score = 29.6 bits (65), Expect = 1.8 Identities = 20/55 (36%), Positives = 25/55 (45%) Frame = +2 Query: 158 KGEHIKGMTLRGGLCSWQLLWCISRLEIVLQCKNLNGLVLHTLDGVHGSPSTIHG 322 KGE+ + GLCS L C L I L L G +LH L V G+ + G Sbjct: 328 KGEYCLLLCFCVGLCSRLRLRCADFLHICLLDVCLRGFLLHDLVAVLGNIDVVFG 382
>FSHR_FELCA (Q5GJ04) Follicle-stimulating hormone receptor precursor (FSH-R)| (Follitropin receptor) Length = 695 Score = 29.3 bits (64), Expect = 2.3 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 166 LSLFHVMSLF*YMNYNLAPCGILLICCCDSHL-LPVSEPHLVAGCLESKI 20 LS +VMSL L ++ICCC +H+ L V P++V+ ++KI Sbjct: 526 LSQLYVMSLL-----VLNVLAFVVICCCYAHIYLTVRNPNIVSSSSDTKI 570
>SYY_MIMIV (Q5UPJ7) Tyrosyl-tRNA synthetase (EC 6.1.1.1) (Tyrosine--tRNA| ligase) (TyrRS) Length = 346 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 3/33 (9%) Frame = +1 Query: 109 MAQDCSSYTRIKTLHGKGR---AHKGYDPKGRL 198 +A++C + R+K L GR A+ G++P GR+ Sbjct: 19 IAEECETLDRLKQLVDSGRIFTAYNGFEPSGRI 51
>COFE_HALMA (Q5UZQ7) F420-0:gamma-glutamyl ligase (EC 6.3.2.-)| Length = 257 Score = 28.5 bits (62), Expect = 4.0 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 121 CSSYTRIKTLHGKGRAHKGYDPKGRLVQLATSV 219 C + T + +G+GR+ Y+P GR ++A ++ Sbjct: 35 CVASTIVSKANGRGRSLSSYEPSGRAERIAATI 67
>CARB_RALSO (Q8XZ83) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1081 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSI 263 ALA +V TT+ GARA ++ +K ++N + Sbjct: 1042 ALANRVTYYTTIAGARAAVEGLKHLQNLDV 1071
>CARB_METBA (P13258) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) (Fragment) Length = 398 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSM-KNKSIKILALQDY 239 A+ +KVP ITT+ A A AI++M K + + I ++ +Y Sbjct: 350 AVDFKVPYITTMQAAIAAAAAIETMKKGEELTIKSINEY 388
>Y4XM_RHISN (P55705) Hypothetical transport protein y4xM| Length = 404 Score = 28.1 bits (61), Expect = 5.2 Identities = 21/55 (38%), Positives = 24/55 (43%) Frame = -2 Query: 320 RGWCSGYHGRHQEYEEQVH*DSCIARLFPAC*CTTEVASCTSRPLGSYPLCALPF 156 +G C+GY Q Y +V ARLF T V S LG L ALPF Sbjct: 115 QGACAGYIAPAQAYGVEVTGGRDRARLFAWLQVATNVGSLGGAFLGGLILDALPF 169
>CARB_BUCAI (P57244) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1078 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSIKIL 254 AL YKV TTV+GA AT+ A+ K+I+ L Sbjct: 1032 ALQYKVHYDTTVNGAFATVMALNENPIKNIETL 1064
>THII_MYCPN (P75228) Probable thiamine biosynthesis protein thiI| Length = 387 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 290 GVHGSPSTIHGCNYGDLVGQG 352 G+H P+TI C YG+LV +G Sbjct: 2 GLHNEPNTILICRYGELVLKG 22
>CARB_CLOAB (Q97FT3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1065 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKS-IKILALQDYF 236 A YKV T +D A+A + AIK + ++ ++ A+++YF Sbjct: 1025 AAEYKVGAFTCIDTAKAFLTAIKVKREEAKVEYRAMKEYF 1064
>CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -3 Query: 352 ALAYKVPIITTVDGARATMDAIKSMKNKSIKILALQDY 239 AL KVP TT GA A AI +++ + LQ Y Sbjct: 1059 ALMMKVPYYTTSAGALAAAQAIAGAPAEALDVRPLQSY 1096
>GLK_NEIMB (P64254) Glucokinase (EC 2.7.1.2) (Glucose kinase)| Length = 328 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -1 Query: 123 TILRHVGFCLSAAAIVTYCQCRNHIWLLGVWSQKSMLGI 7 T +RH F ++ + + Q NH W + + + LG+ Sbjct: 62 TAVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQTLGL 100
>GLK_NEIMA (P64253) Glucokinase (EC 2.7.1.2) (Glucose kinase)| Length = 328 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -1 Query: 123 TILRHVGFCLSAAAIVTYCQCRNHIWLLGVWSQKSMLGI 7 T +RH F ++ + + Q NH W + + + LG+ Sbjct: 62 TAVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQTLGL 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,534,585 Number of Sequences: 219361 Number of extensions: 1280869 Number of successful extensions: 2923 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 2867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2923 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
