Clone Name | rbastl05a05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RHAAB_BACSK (Q5WL39) RhaA/rhaB bifunctional enzyme [Includes: Rh... | 31 | 1.7 | 2 | DMWD_MOUSE (Q08274) Dystrophia myotonica WD repeat-containing pr... | 29 | 5.0 | 3 | CHD2_HUMAN (O14647) Chromodomain-helicase-DNA-binding protein 2 ... | 29 | 6.6 |
---|
>RHAAB_BACSK (Q5WL39) RhaA/rhaB bifunctional enzyme [Includes: Rhamnulokinase| (EC 2.7.1.5) (Rhamnulose kinase); L-rhamnose isomerase (EC 5.3.1.14)] Length = 894 Score = 30.8 bits (68), Expect = 1.7 Identities = 21/53 (39%), Positives = 24/53 (45%) Frame = -3 Query: 357 RRAVRLAKAVTYIWPHSRELHQSSRGIGVAIKRS*CGTSVGAAFHRVN*HPES 199 R VR A VTY P E H SSR ++ G V AAF +V P S Sbjct: 451 RALVRTAFPVTYFLPQRSESHVSSRFESAKVQYEQLGIDVEAAFAKVKQVPIS 503
>DMWD_MOUSE (Q08274) Dystrophia myotonica WD repeat-containing protein| (Dystrophia myotonica-containing WD repeat motif protein) (DMR-N9 protein) Length = 650 Score = 29.3 bits (64), Expect = 5.0 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 422 FSPSGRHVLCIGKDGSL 372 FSP GRH+ C+ +DG L Sbjct: 274 FSPDGRHLACVSQDGCL 290
>CHD2_HUMAN (O14647) Chromodomain-helicase-DNA-binding protein 2 (EC 3.6.1.-)| (ATP-dependent helicase CHD2) (CHD-2) Length = 1739 Score = 28.9 bits (63), Expect = 6.6 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = +3 Query: 27 HRSRDARKKEEIRAPQHSQFTNDNSYKNHMTSQQIQQRGC*QPDTKMC 170 HRS R R + Q+++D ++ H +GC P +C Sbjct: 1684 HRSGSYRPNNMSRKRPYDQYSSDRDHRGHRDYYDRYAKGCETPGANLC 1731 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,760,640 Number of Sequences: 219361 Number of extensions: 1305686 Number of successful extensions: 2504 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2504 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)