Clone Name | rbastl05a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLGA2_ANASP (Q8Z0Q9) Probable glycogen synthase 2 (EC 2.4.1.21) ... | 30 | 2.3 | 2 | GLGA1_ANAVT (Q3M9U1) Glycogen synthase 1 (EC 2.4.1.21) (Starch [... | 30 | 2.9 | 3 | SECE_BUCAI (P57152) Preprotein translocase secE subunit | 29 | 5.0 | 4 | SATT_HUMAN (P43007) Neutral amino acid transporter A (SATT) (Ala... | 29 | 5.0 | 5 | KCM1_XENLA (Q91636) Kinesin central motor 1 (XKCM1) | 29 | 6.6 |
---|
>GLGA2_ANASP (Q8Z0Q9) Probable glycogen synthase 2 (EC 2.4.1.21) (Starch| [bacterial glycogen] synthase 2) Length = 492 Score = 30.4 bits (67), Expect = 2.3 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 173 SCSKPVAAWIGKTDNEK-IAVLHNCFELLLRRGSKLCGVDTTTKGG 307 + KP+ A+IG+ DN+K + ++H+ L +G++ + + T+ G Sbjct: 296 AADKPIIAYIGRLDNQKGVHLVHHAIYHALNKGAQFVLLGSATEAG 341
>GLGA1_ANAVT (Q3M9U1) Glycogen synthase 1 (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase 1) Length = 492 Score = 30.0 bits (66), Expect = 2.9 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 173 SCSKPVAAWIGKTDNEK-IAVLHNCFELLLRRGSKLCGVDTTTKGG 307 + KP+ A+IG+ DN+K + ++H+ L +G++ + + T+ G Sbjct: 296 AADKPIIAYIGRLDNQKGVHLVHHAIYHSLNKGAQFVLLGSATEAG 341
>SECE_BUCAI (P57152) Preprotein translocase secE subunit| Length = 127 Score = 29.3 bits (64), Expect = 5.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 84 YHYRQNKQKAP*SPSWLSFSITPFFLIGDYL 176 +HY +NK K P W+S SI FF++ ++ Sbjct: 4 HHYNRNKHKIPEKVKWISISI--FFILSFFI 32
>SATT_HUMAN (P43007) Neutral amino acid transporter A (SATT)| (Alanine/serine/cysteine/ threonine transporter) (ASCT1) Length = 532 Score = 29.3 bits (64), Expect = 5.0 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 11/91 (12%) Frame = -1 Query: 282 PQSLLPRRRSNSKQLCKTAIFSLSVFPIHAATGL-----------LQDSHL*EKRELWRR 136 P + R R + L + A+ L+V + A GL Q ++L E+ R Sbjct: 25 PGTAAGRARRCAGFLRRQALVLLTVSGVLAGAGLGAALRGLSLSRTQVTYLAFPGEMLLR 84 Query: 135 ITKMVIMELSVCFACSDSLVLCFFCLMRIGG 43 + +M+I+ L VC S + L CL R+GG Sbjct: 85 MLRMIILPLVVCSLVSGAASLDASCLGRLGG 115
>KCM1_XENLA (Q91636) Kinesin central motor 1 (XKCM1)| Length = 730 Score = 28.9 bits (63), Expect = 6.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 236 HNCFELLLRRGSKLCGVDTTTKGGGQER 319 H C +++LRRGSKL G + G ER Sbjct: 475 HACLQIILRRGSKLHGKFSLVDLAGNER 502 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,896,463 Number of Sequences: 219361 Number of extensions: 1353078 Number of successful extensions: 3050 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3049 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)