Clone Name | rbastl04h11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | P2Y10_HUMAN (O00398) Putative P2Y purinoceptor 10 (P2Y10) (P2Y-l... | 28 | 6.9 |
---|
>P2Y10_HUMAN (O00398) Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)| Length = 339 Score = 28.1 bits (61), Expect = 6.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 130 VTLVGQLRVVAVIGLVALFLLFNYCEWKTYV 38 V LVG + V + G V ++ +C WKT + Sbjct: 193 VALVGMITVAELAGFVIPVIIIAWCTWKTTI 223 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,467,934 Number of Sequences: 219361 Number of extensions: 274595 Number of successful extensions: 963 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 963 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)