Clone Name | rbastl04h07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CCNC_MOUSE (Q62447) Cyclin-C | 29 | 4.9 | 2 | CCNC_RAT (P39947) Cyclin-C | 29 | 4.9 | 3 | T4S19_HUMAN (Q96DZ7) Transmembrane 4 L6 family 19 | 28 | 8.4 |
---|
>CCNC_MOUSE (Q62447) Cyclin-C| Length = 304 Score = 29.3 bits (64), Expect = 4.9 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 149 YGFRLEFCMSGLWFLLYVADCCLHLYHLCFPTI-YFNTLGLHYVYVPV 9 + +R+ + ++LL + DCCL +YH P + Y +G V +P+ Sbjct: 149 FPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDVLLPL 196
>CCNC_RAT (P39947) Cyclin-C| Length = 298 Score = 29.3 bits (64), Expect = 4.9 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 149 YGFRLEFCMSGLWFLLYVADCCLHLYHLCFPTI-YFNTLGLHYVYVPV 9 + +R+ + ++LL + DCCL +YH P + Y +G V +P+ Sbjct: 143 FPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDVLLPL 190
>T4S19_HUMAN (Q96DZ7) Transmembrane 4 L6 family 19| Length = 209 Score = 28.5 bits (62), Expect = 8.4 Identities = 10/43 (23%), Positives = 23/43 (53%) Frame = -3 Query: 151 YMDSDWNFACLDCGFCCTLRIVAYTCIICVSQLYILTLLAYIM 23 Y S WN CL+ + ++ ++C+S L +L ++ +++ Sbjct: 154 YDRSLWNSVCLEPSAAVVWHVSLFSALLCISLLQLLLVVVHVI 196 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,364,825 Number of Sequences: 219361 Number of extensions: 1362614 Number of successful extensions: 3351 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3350 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)