Clone Name | rbastl04f09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VATB2_TREPA (O83540) V-type ATP synthase beta chain 2 (EC 3.6.3.... | 29 | 4.5 |
---|
>VATB2_TREPA (O83540) V-type ATP synthase beta chain 2 (EC 3.6.3.14) (V-type| ATPase subunit B 2) Length = 480 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 271 KLPCK*SQGLLYNRLIIDMQRKANILSTHQIPVQAFLG 384 KLP GL +NRL + R+A IL T + V F G Sbjct: 147 KLPIFSGNGLAHNRLAAQIIRQAKILGTDEAFVMVFAG 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,503,952 Number of Sequences: 219361 Number of extensions: 1075283 Number of successful extensions: 1791 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1791 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)