ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl04f08 |
|---|---|
| Clone Library Name | barley_pub |
>Y2349_CORGL (Q8NN60) Hypothetical UPF0230 protein Cgl2349/cg2579| Length = 274 Score = 30.4 bits (67), Expect = 1.1 Identities = 19/53 (35%), Positives = 32/53 (60%) Frame = -2 Query: 346 SSTVSDVNSMNRIVDLSSQVQHVGAMESISVTMAEDGASHEPDHDLSDVSMSR 188 ++ V D +S+ R+VD SS VGA + MA+DGAS + +D++ ++ R Sbjct: 82 AAAVFDDDSV-RVVDTSSLGMAVGAAAMAAARMAKDGASLQECYDIAVDTLKR 133
>HAIR_MOUSE (Q61645) Protein hairless| Length = 1182 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -2 Query: 310 IVDLSSQVQHVGAMES--ISVTMAEDGASHEPDHDLSDVSMSRVFFQLIKA 164 +V S QH + E+ +S + GAS PDH + M R FQ +KA Sbjct: 1123 LVSTISVTQHFLSPETSALSAQLYHQGASLPPDHRMLYAQMDRAVFQAVKA 1173
>GRP78_APLCA (Q16956) 78 kDa glucose-regulated protein precursor (GRP 78) (BiP)| (Protein 1603) Length = 667 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +2 Query: 77 FNKKRKKIQGLLTP-LTVPYRSSGAFSPPLGFDQLKE 184 FN+K+ +++G++ P +T Y SG PP G ++ +E Sbjct: 625 FNEKKTELEGIVQPIMTKLYEQSGGAPPPSGEEESEE 661
>HAIR_RAT (P97609) Protein hairless| Length = 1181 Score = 29.6 bits (65), Expect = 1.9 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = -2 Query: 310 IVDLSSQVQHVGAMES--ISVTMAEDGASHEPDHDLSDVSMSRVFFQLIK 167 +V S QH + E+ +S + GAS PDH + M R FQ +K Sbjct: 1122 LVSTISVTQHFLSPETSALSAQLCHQGASLPPDHRMLYAQMDRAVFQAVK 1171
>TMM24_HUMAN (O14523) Transmembrane protein 24 (Protein DLNB23)| Length = 706 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = -2 Query: 361 LQDADSSTVSDVNSMNRIVDLSSQVQHVGAMESISV 254 +Q+AD +T SD++ + D+ S+ GA+E+ S+ Sbjct: 597 VQEADETTRSDISERPSVDDIESETGSTGALETRSL 632
>VXIS_BPMD2 (O22002) Excisionase (Excisase) (Gp34)| Length = 78 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -1 Query: 368 PAAPGRGFFDRVGREQHEPDRRPVVAGSARRCHGEHQRDDGGGRSFARA*PR 213 P G G R ++ E +RP V + + HG H+RD+ R PR Sbjct: 20 PVRLGVGHVARDRHQRREDQQRPGVPTVSAQGHGRHRRDEDASVDNERDHPR 71
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 28.1 bits (61), Expect = 5.4 Identities = 25/97 (25%), Positives = 34/97 (35%) Frame = +1 Query: 67 SGKLQQEKKKNPRLAHTPNGTLQIIRRVFTSPRL*SAERKPCSSTRRRGRGQARAKLXXX 246 SG + + P+ +H NG + RR S + RK T RGR + Sbjct: 496 SGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSP----- 550 Query: 247 XXXXXXXXXXXXAEPATTGRRSGSCCSRPTRSKNPRP 357 + P T RRS S P R + P P Sbjct: 551 ------------SPPPTRRRRSPSPAPPPRRRRTPTP 575
>TMM24_MOUSE (Q80X80) Transmembrane protein 24| Length = 706 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = -2 Query: 361 LQDADSSTVSDVNSMNRIVDLSSQVQHVGAMESISV 254 +Q+AD +T SD++ + D+ S+ GA+E+ S+ Sbjct: 597 VQEADETTRSDISERPSVDDVESETGSTGALETRSL 632
>DDLB_PSESM (Q87WY7) D-alanine--D-alanine ligase B (EC 6.3.2.4)| (D-alanylalanine synthetase B) (D-Ala-D-Ala ligase B) Length = 319 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 98 IQGLLTPLTVPYRSSGAFSPPLGFDQLK 181 +QGLL L +PY SG + L D+L+ Sbjct: 88 MQGLLECLEIPYTGSGVLASALAMDKLR 115
>SPX_LISMO (Q9RGX0) Regulatory protein spx| Length = 131 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 92 KKIQGLLTPLTVPYRSSGAFSPPLGFDQLKE 184 +K + L +PY+ FS PL D++KE Sbjct: 14 RKARAWLEEHDIPYKERNIFSEPLSLDEIKE 44
>SPX_LISMF (Q71XH4) Regulatory protein spx| Length = 131 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 92 KKIQGLLTPLTVPYRSSGAFSPPLGFDQLKE 184 +K + L +PY+ FS PL D++KE Sbjct: 14 RKARAWLEEHDIPYKERNIFSEPLSLDEIKE 44
>SPX_LISIN (P60377) Regulatory protein spx| Length = 131 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 92 KKIQGLLTPLTVPYRSSGAFSPPLGFDQLKE 184 +K + L +PY+ FS PL D++KE Sbjct: 14 RKARAWLEEHDIPYKERNIFSEPLSLDEIKE 44
>DDL_ANASP (Q8YY71) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) Length = 364 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 98 IQGLLTPLTVPYRSSGAFSPPLGFDQL 178 IQGLLT + P+ SG LG D++ Sbjct: 116 IQGLLTLMQTPFVGSGVLGSALGMDKI 142
>SAS_DROME (Q04164) Putative epidermal cell surface receptor precursor| (Stranded at second protein) Length = 1693 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 4/60 (6%) Frame = -2 Query: 361 LQDADSSTVSDVNSMNR----IVDLSSQVQHVGAMESISVTMAEDGASHEPDHDLSDVSM 194 +++++SS+ ++ ++ V + + + G I + + +G++HE DLSDVSM Sbjct: 429 VKESESSSTTEASTTTTEPSPFVAFAGEGRSAGGGNDIELFLHHNGSTHEQLMDLSDVSM 488
>HPRK_NEIMB (Q9K081) HPr kinase/phosphorylase (EC 2.7.11.-) (EC 2.7.4.-)| (HPrK/P) (HPr(Ser) kinase/phosphorylase) Length = 320 Score = 27.3 bits (59), Expect = 9.2 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = -2 Query: 355 DADSSTVSDVNSMNRIVDLSSQVQHVGAMESISVTMAEDGASHEPDHDLSDVSMSRV 185 +AD ++ V +N I +Q+Q VG ES + E G + DL D+SMS V Sbjct: 35 EADKPVLALVGHLNFIHP--NQIQVVGLAESEYLNRLESGETGYQFGDLFDISMSLV 89
>HPRK_NEIMA (Q9JV91) HPr kinase/phosphorylase (EC 2.7.11.-) (EC 2.7.4.-)| (HPrK/P) (HPr(Ser) kinase/phosphorylase) Length = 320 Score = 27.3 bits (59), Expect = 9.2 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = -2 Query: 355 DADSSTVSDVNSMNRIVDLSSQVQHVGAMESISVTMAEDGASHEPDHDLSDVSMSRV 185 +AD ++ V +N I +Q+Q VG ES + E G + DL D+SMS V Sbjct: 35 EADKPVLALVGHLNFIHP--NQIQVVGLAESEYLNRLESGETGYQFGDLFDISMSLV 89
>ZO1_CANFA (O97758) Tight junction protein ZO-1 (Zonula occludens 1 protein)| (Zona occludens 1 protein) (Tight junction protein 1) Length = 1769 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 227 RA*PRPLRRVDEQGFLSADQSRGEVKT 147 +A P+P+ R+D GF +A Q + E + Sbjct: 900 QAQPQPIHRIDSPGFKTASQQKAEASS 926
>NACA_BABDI (Q45FF9) Nascent polypeptide-associated complex alpha subunit| (NAC-alpha) (Alpha-NAC) Length = 197 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -2 Query: 349 DSSTVSDVNSMNRIVDLSSQVQHVGAMESISVTMAEDGASHEPDHD 212 D S S + + R+ LSS +Q VGA + A + H+ HD Sbjct: 96 DMSQNSALEAAQRLSQLSSALQAVGADRGTDSSAAAHASGHDHAHD 141
>DDLB_PSEPK (Q88N74) D-alanine--D-alanine ligase B (EC 6.3.2.4)| (D-alanylalanine synthetase B) (D-Ala-D-Ala ligase B) Length = 318 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 98 IQGLLTPLTVPYRSSGAFSPPLGFDQLK 181 +QGLL L +PY SG + L D+L+ Sbjct: 87 MQGLLECLGIPYTGSGILASALAMDKLR 114
>DDL_RICCN (Q92IT7) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) Length = 321 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 98 IQGLLTPLTVPYRSSGAFSPPLGFDQL 178 + GLL + +PY SG S L FD++ Sbjct: 92 LPGLLNIMRIPYTHSGVLSSALAFDKI 118
>UL24_ILTVT (P23986) Protein UL24 homolog (ORF 3)| Length = 287 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +1 Query: 61 HVSGKLQQEKKKNPRLAHTPNGTLQIIRRVFTSPRL*SAERKPCS 195 H K QQE KN LA LQ + +F+S + KP S Sbjct: 221 HARSKYQQESAKNADLASPAPSALQTVAALFSSRVGKESATKPAS 265 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,899,315 Number of Sequences: 219361 Number of extensions: 846397 Number of successful extensions: 2390 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2390 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
