ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl04e08 |
|---|---|
| Clone Library Name | barley_pub |
>CX022_HUMAN (Q6ZTR5) Protein CXorf22| Length = 976 Score = 30.4 bits (67), Expect = 1.9 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -2 Query: 218 SLLPCEISNPCEL--VWYHVDCELNIELGSCKSKCVGFSVCVPVCSFL 81 S + C I N CEL V YH N E+ K K G + +CSF+ Sbjct: 430 SEIQCIIKNQCELLPVTYHFKKTANFEIDPEKGKITGGGMVDVMCSFV 477
>ECM5_YEAST (Q03214) Extracellular matrix protein 5| Length = 1411 Score = 30.0 bits (66), Expect = 2.4 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -2 Query: 218 SLLPCEISNPCELVWYHVDCELNIELGSCKSKCVGF--SVCVPVC 90 +++ CEI WYHVDC N EL V F S+C P C Sbjct: 1251 AMVECEICKE----WYHVDCISNGELVPPDDPNVLFVCSICTPPC 1291
>ISPE_SALPA (Q5PCR2) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 282 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 200 TLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGTGACV 243
>ISPE_SALTY (P30753) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGTGACV 244
>ISPE_SALTI (Q8Z699) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGTGACV 244
>ISPE_SALCH (Q57NN2) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGTGACV 244
>ISPE_SHISS (Q3Z0S6) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACV 244
>ISPE_SHIFL (Q83LD8) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACV 244
>ISPE_SHIDS (Q32GZ9) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACV 244
>ISPE_SHIBS (Q31ZQ1) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACV 244
>ISPE_ECOLI (P62615) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACV 244
>ISPE_ECOL6 (Q8FI04) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACV 244
>ISPE_ECO57 (P62616) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 283 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = -2 Query: 218 SLLPCEISNPCELV----WYHVDCELNIELGSCKSKCVGFSVCV 99 +LL CE SN CE++ + VD L+ L S+ G CV Sbjct: 201 TLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACV 244 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,652,495 Number of Sequences: 219361 Number of extensions: 1111493 Number of successful extensions: 2064 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2058 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
