Clone Name | rbastl04e07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | C8AP2_MOUSE (Q9WUF3) CASP8-associated protein 2 (FLICE-associate... | 29 | 3.7 | 2 | SHS1_YEAST (Q07657) Seventh homolog of septin 1 (Septation prote... | 29 | 4.9 |
---|
>C8AP2_MOUSE (Q9WUF3) CASP8-associated protein 2 (FLICE-associated huge protein)| Length = 1962 Score = 29.3 bits (64), Expect = 3.7 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +3 Query: 279 PGYVILHEESK--FIIIIRNALPSLTAGIRHRIIA 377 P + ++ E+S FI+ IR A PS + G++H ++A Sbjct: 1507 PMHAVIMEKSNDHFIVKIRRATPSTSPGLKHGVVA 1541
>SHS1_YEAST (Q07657) Seventh homolog of septin 1 (Septation protein 7)| Length = 551 Score = 28.9 bits (63), Expect = 4.9 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 5/54 (9%) Frame = +2 Query: 65 FSSNISEYKNVPATFSY-----YLQSNDQRKLMLPPLGMQLISSYPLPKYISEF 211 F++N+ E K P + Y + SN + K++ P + S +P Y+SEF Sbjct: 39 FANNLLETKIFPHKYQYGKSNASISSNPEVKVIAPTKVVSFNSKNGIPSYVSEF 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,777,260 Number of Sequences: 219361 Number of extensions: 1189272 Number of successful extensions: 2650 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2650 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)