ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl04e04 |
|---|---|
| Clone Library Name | barley_pub |
>CLFA_STAAR (Q6GIK4) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 1029 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 287 LPGGSKADPNNHNSS*DSGSESLVFSGASDTDDFSVDSGS 406 +P S +DP + + S DSGS+S SG+ D + DSGS Sbjct: 557 IPEDSDSDPGSDSGS-DSGSDSNSDSGSDSGSDSTSDSGS 595
>RED1_YEAST (P14291) Protein RED1| Length = 827 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 411 EPEPESTEKSSVSDAPEKTNDSEPESHDEL 322 EPE E E+ + A E+ D E ES DEL Sbjct: 364 EPENEGEEEEQIGRADEQKEDEEEESLDEL 393
>ATPG_BUCAI (P57123) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +3 Query: 198 ATNSYTNLVFRPSNKTVVQTIFSEYIEQYLSQ 293 A+N+ + ++ P +K ++ T+F+ YIE + Q Sbjct: 199 ASNNNWDYLYEPESKLILDTLFNRYIESQVYQ 230
>V2A_BBMV (P27462) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (protein 2A)| Length = 810 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 63 HCCTETHLYFDNSYYRDF 10 H +TH YFD+SYY F Sbjct: 251 HNALKTHAYFDDSYYEGF 268
>CLFA_STAAU (Q53653) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 933 Score = 27.3 bits (59), Expect = 8.8 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +2 Query: 290 PGGSKADPNNHNSS*DSGSESLVFSG---ASDTDDFSVDSGS 406 PG +N +S DSGS+S SG ASD+D S DS S Sbjct: 565 PGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSAS-DSDS 605
>CLFA_STAAC (Q5HHM8) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 933 Score = 27.3 bits (59), Expect = 8.8 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +2 Query: 290 PGGSKADPNNHNSS*DSGSESLVFSG---ASDTDDFSVDSGS 406 PG +N +S DSGS+S SG ASD+D S DS S Sbjct: 565 PGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSAS-DSDS 605
>CLFA_STAAM (Q932C5) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 935 Score = 27.3 bits (59), Expect = 8.8 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +2 Query: 290 PGGSKADPNNHNSS*DSGSESLVFSG---ASDTDDFSVDSGS 406 PG +N +S DSGS+S SG ASD+D S DS S Sbjct: 565 PGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSAS-DSDS 605
>PER1_RAT (Q8CHI5) Period circadian protein 1 (rPER1) (Fragment)| Length = 1244 Score = 27.3 bits (59), Expect = 8.8 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 290 PGGSKADPNNHNSS*DSGSESLVFS--GASDTDDFSVDSGSG 409 PG S AD + NS+ SG+ES GAS S SG+G Sbjct: 37 PGPSLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNG 78
>PER1_HUMAN (O15534) Period circadian protein 1 (Circadian pacemaker protein| Rigui) (hPER) Length = 1290 Score = 27.3 bits (59), Expect = 8.8 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 290 PGGSKADPNNHNSS*DSGSESLVFS--GASDTDDFSVDSGSG 409 PG S AD + NS+ SG+ES GAS S SG+G Sbjct: 37 PGPSLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNG 78
>CLFA_STAAS (Q6GB45) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 928 Score = 27.3 bits (59), Expect = 8.8 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +2 Query: 290 PGGSKADPNNHNSS*DSGSESLVFSG---ASDTDDFSVDSGS 406 PG +N +S DSGS+S SG ASD+D S DS S Sbjct: 564 PGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSAS-DSDS 604
>CLFA_STAAN (Q99VJ4) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 989 Score = 27.3 bits (59), Expect = 8.8 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +2 Query: 290 PGGSKADPNNHNSS*DSGSESLVFSG---ASDTDDFSVDSGS 406 PG +N +S DSGS+S SG ASD+D S DS S Sbjct: 565 PGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSAS-DSDS 605
>CLFA_STAAW (Q8NXJ1) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 946 Score = 27.3 bits (59), Expect = 8.8 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +2 Query: 290 PGGSKADPNNHNSS*DSGSESLVFSG---ASDTDDFSVDSGS 406 PG +N +S DSGS+S SG ASD+D S DS S Sbjct: 564 PGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSAS-DSDS 604 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,822,520 Number of Sequences: 219361 Number of extensions: 1011880 Number of successful extensions: 2340 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2319 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
