ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl04d10 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 95.9 bits (237), Expect = 4e-20 Identities = 42/59 (71%), Positives = 52/59 (88%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVTEADG 268 ++NHYG M SG YTA+IKLLD++RW NFDDSH+S INE++VKSGAAYVLFYRR ++A G Sbjct: 863 LTNHYGGMGSGHYTAHIKLLDDSRWYNFDDSHISHINEDDVKSGAAYVLFYRRKSDAGG 921
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 67.8 bits (164), Expect = 1e-11 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 VSNHYG M G YTA+ K D+ +W FDDS VS +E+++ S AAYVLFY+R Sbjct: 880 VSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQR 932
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 67.8 bits (164), Expect = 1e-11 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 VSNHYG M G YTA+ K D+ +W FDDS VS +E+++ S AAYVLFY+R Sbjct: 880 VSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQR 932
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 67.8 bits (164), Expect = 1e-11 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY-RRVTEADG 268 V NHYG + G YTAY+K +N+W FDDS V+ E +G+AY+LFY RR + +G Sbjct: 1057 VDNHYGGLGGGHYTAYVKNFADNKWYYFDDSRVTETAPENSIAGSAYLLFYIRRHKDGNG 1116 Query: 267 AASNGTQSCVKRSR 226 S+ Q +++SR Sbjct: 1117 LGSSKLQEIIQKSR 1130
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 64.3 bits (155), Expect = 1e-10 Identities = 28/53 (52%), Positives = 36/53 (67%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 VSNHYG M G YT + D +W FDD+ VS +NE +++S AAYVLFY+R Sbjct: 834 VSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQR 886
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 63.5 bits (153), Expect = 2e-10 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 VSNHYG+M G YTAY K +W FDDS+VS +E+++ + AAYVLFY+R Sbjct: 870 VSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQR 922
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 63.5 bits (153), Expect = 2e-10 Identities = 33/66 (50%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY-RRVTEADG 268 VSNHYG+M G YTAY K +W FDDS VS +E+++ + AAYVLFY RR E Sbjct: 869 VSNHYGAMGVGHYTAYAKNRLNGKWYYFDDSSVSLASEDQIVTKAAYVLFYQRRDDECSS 928 Query: 267 AASNGT 250 +S G+ Sbjct: 929 TSSLGS 934
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 62.4 bits (150), Expect = 5e-10 Identities = 29/51 (56%), Positives = 32/51 (62%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 VSNHYG + G YTAY K RW FDD VS I+ VKS AAY+LFY Sbjct: 1056 VSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFY 1106
>UBP11_MOUSE (Q99K46) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 797 Score = 62.0 bits (149), Expect = 6e-10 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 VSNHYG M G YT + D +W DD+ VS +NE +++S AAYVLFY+R Sbjct: 712 VSNHYGGMRDGHYTTFACNKDSGQWHYLDDNSVSPVNENQIESKAAYVLFYQR 764
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 61.2 bits (147), Expect = 1e-09 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 VSNHYG + G YTAY K RW FDD VS I+ V+S AAY+LFY Sbjct: 1018 VSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVRSSAAYILFY 1068
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 58.2 bits (139), Expect = 9e-09 Identities = 27/55 (49%), Positives = 35/55 (63%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVT 280 V NHYG + G YTA+ K D ++ FDDS V+ + EE + AAY+LFYRR T Sbjct: 924 VDNHYGGLGGGHYTAFAKNPDNGQFYCFDDSRVTPVCPEETVTSAAYLLFYRRKT 978
>UBP11_CANFA (Q01988) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 445 Score = 55.8 bits (133), Expect = 5e-08 Identities = 25/53 (47%), Positives = 34/53 (64%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 VSNHYG + G YT + D + FDD+ VS + E +++S AAYVLFY+R Sbjct: 359 VSNHYGGLRDGHYTTFACNKDSGQSDYFDDNSVSPVTENQIESKAAYVLFYQR 411
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 52.8 bits (125), Expect = 4e-07 Identities = 23/53 (43%), Positives = 34/53 (64%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 277 H+G+ +SG Y AY + N W FDD V+ ++E V++ AYVLFYR+ +E Sbjct: 665 HHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSE 717
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 52.0 bits (123), Expect = 7e-07 Identities = 22/52 (42%), Positives = 34/52 (65%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYR 289 V NH+G M++G YTAY + + FDD+ + I+ E++ + +AYVLFYR Sbjct: 795 VDNHHGFMSNGHYTAYARDASSQTFFKFDDTAICEIDPEDIVTSSAYVLFYR 846
>UBP19_HUMAN (O94966) Ubiquitin carboxyl-terminal hydrolase 19 (EC 3.1.2.15)| (Ubiquitin thioesterase 19) (Ubiquitin-specific-processing protease 19) (Deubiquitinating enzyme 19) (Zinc finger MYND domain-containing protein 9) (Fragment) Length = 1371 Score = 52.0 bits (123), Expect = 7e-07 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 7/60 (11%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENR-------WSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 V NHYG M G YTA +L ++ W FDDS V+ ++E +V + AYVLFYRR Sbjct: 1207 VINHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRR 1266
>UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 357 Score = 51.6 bits (122), Expect = 9e-07 Identities = 23/51 (45%), Positives = 32/51 (62%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 VSNH G+ G YTAY K + W +F+DS V+ ++ V+S AY+LFY Sbjct: 298 VSNHSGTTMGGHYTAYCKSPISSEWHSFNDSRVTPMSSSHVRSSDAYLLFY 348
>UBP20_HUMAN (Q9Y2K6) Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.1.2.15)| (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (Deubiquitinating enzyme 20) Length = 913 Score = 51.6 bits (122), Expect = 9e-07 Identities = 21/53 (39%), Positives = 34/53 (64%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 277 H+G+ SG Y AY + + +W FDD +V+ ++E V++ YVLFYR+ +E Sbjct: 634 HHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSE 686
>UBP2_HUMAN (O75604) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 605 Score = 49.3 bits (116), Expect = 4e-06 Identities = 21/51 (41%), Positives = 31/51 (60%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 VSNH G+ G YTAY + W F+DS V+ ++ +V++ AY+LFY Sbjct: 546 VSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFY 596
>UBP2_MOUSE (O88623) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 353 Score = 48.5 bits (114), Expect = 7e-06 Identities = 21/51 (41%), Positives = 31/51 (60%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 VSNH G+ G YTAY + W F+DS V+ ++ +V++ AY+LFY Sbjct: 294 VSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVRTSDAYLLFY 344
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 46.6 bits (109), Expect = 3e-05 Identities = 24/49 (48%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = -3 Query: 435 HYGS-MASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 H+GS + SG YTAY + E RW +F+DS V+ +EE V AY+LFY Sbjct: 462 HHGSGVGSGHYTAY--AVHEGRWFHFNDSTVTVTDEETVGKAKAYILFY 508
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 45.8 bits (107), Expect = 5e-05 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVK 319 V H GS A G Y A IK + +W +FDD HVS I +E++K Sbjct: 492 VMAHSGSAAGGHYYACIKSFSDEQWYSFDDQHVSRITQEDIK 533
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 45.4 bits (106), Expect = 6e-05 Identities = 24/49 (48%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = -3 Query: 435 HYGS-MASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 H+GS + SG YTAY E RW +F+DS V+ +EE V AY+LFY Sbjct: 463 HHGSGVGSGHYTAY--ATHEGRWFHFNDSTVTLTDEETVVKAKAYILFY 509
>UBP4_YEAST (P32571) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Vacuole biogenesis protein SSV7) Length = 926 Score = 45.1 bits (105), Expect = 8e-05 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAI-NEEEVKSGAAYVLFYRRV 283 V+ H+G++ G YTAY+K + W FDD+ + N+ + + AYVLFY RV Sbjct: 869 VACHFGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNKADAINSNAYVLFYHRV 923
>UBPL_MIMIV (Q5UQR3) Probable ubiquitin carboxyl-terminal hydrolase (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin specific-processing protease) (Deubiquitinating enzyme) Length = 468 Score = 45.1 bits (105), Expect = 8e-05 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 V NH+G + +G Y Y K+ + W F+D++ + + + + AY+LFY R Sbjct: 409 VINHHGGLNNGHYFTYSKIENTGEWYEFNDTYTGKVTDNHIVNQNAYILFYIR 461
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 44.7 bits (104), Expect = 1e-04 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = -3 Query: 438 NHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 277 NH GS+ G YTA + + W ++DS VS ++E +V S YVLFY+ + E Sbjct: 509 NHSGSVHYGHYTALCRC--QTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQE 560
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 44.7 bits (104), Expect = 1e-04 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = -3 Query: 438 NHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 277 NH GS+ G YTA + + W ++DS VS ++E +V S YVLFY+ + E Sbjct: 510 NHSGSVHYGHYTALCRC--QTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQE 561
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 44.7 bits (104), Expect = 1e-04 Identities = 21/51 (41%), Positives = 33/51 (64%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 + +H G++ G Y A+ K+ +W F+DS VS+I++EEV AY+LFY Sbjct: 416 IVSHKGTVNEGHYIAFCKI-SGGQWFKFNDSMVSSISQEEVLKEQAYLLFY 465
>UBPE_DROME (Q24574) Ubiquitin carboxyl-terminal hydrolase 64E (EC 3.1.2.15)| (Ubiquitin thioesterase 64E) (Ubiquitin-specific-processing protease 64E) (Deubiquitinating enzyme 64E) Length = 1556 Score = 44.3 bits (103), Expect = 1e-04 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 17/68 (25%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVK-----------------SGAA 307 H GS + G Y AYIK D N W F+D +V++I +E+++ S A Sbjct: 712 HSGSASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRSFGGPNGSYYSSAYTSSTNA 771 Query: 306 YVLFYRRV 283 Y+L YR+V Sbjct: 772 YMLMYRQV 779
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 43.9 bits (102), Expect = 2e-04 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVK 319 H GS A G Y A IK +++W +F+D HVS I +E++K Sbjct: 495 HSGSAAGGHYYACIKSFSDDQWYSFNDQHVSRITQEDIK 533
>UBP16_HUMAN (Q9Y5T5) Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.1.2.15)| (Ubiquitin thioesterase 16) (Ubiquitin-specific-processing protease 16) (Deubiquitinating enzyme 16) (Ubiquitin-processing protease UBP-M) Length = 823 Score = 42.0 bits (97), Expect = 7e-04 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 22/76 (28%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDEN----------------------RWSNFDDSHVSAINE 331 V H G+M SG YTAY K N +W + D+HV A+ Sbjct: 747 VVEHSGTMRSGHYTAYAKARTANSHLSNLVLHGDIPQDFEMESKGQWFHISDTHVQAVPT 806 Query: 330 EEVKSGAAYVLFYRRV 283 +V + AY+LFY R+ Sbjct: 807 TKVLNSQAYLLFYERI 822
>UBP51_HUMAN (Q70EK9) Ubiquitin carboxyl-terminal hydrolase 51 (EC 3.1.2.15)| (Ubiquitin thioesterase 51) (Ubiquitin-specific-processing protease 51) (Deubiquitinating enzyme 51) Length = 711 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/53 (32%), Positives = 34/53 (64%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 V NH+G++ SG YT++I+ +++W + DD+ ++ E++ Y+LFY + Sbjct: 654 VINHHGTLESGHYTSFIR-QQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHK 705
>UBP44_HUMAN (Q9H0E7) Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.1.2.15)| (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44) (Deubiquitinating enzyme 44) Length = 712 Score = 40.8 bits (94), Expect = 0.002 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY-RRVTE 277 V +H SG YTAY + W + +DS +S +EV AY+LFY +RVTE Sbjct: 625 VMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMCTMDEVCKAQAYILFYTQRVTE 681
>UBP49_MOUSE (Q6P9L4) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 685 Score = 40.4 bits (93), Expect = 0.002 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVTEADGA 265 V +H SG YTAY + W + +DS + + EEV AY+LFY R T A Sbjct: 601 VMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLDVCSVEEVCKTQAYILFYTRRTVQGSA 660 Query: 264 --ASNGTQSCVKRSRRSSQR*FEL 199 + Q+ V S + +R + L Sbjct: 661 KLSEPHLQAQVHSSSKDERRTYTL 684
>UBP2_ARATH (Q8W4N3) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (AtUBP2) Length = 961 Score = 40.0 bits (92), Expect = 0.003 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 8/59 (13%) Frame = -3 Query: 435 HYGSMASGQYTAYI------KLLDENR--WSNFDDSHVSAINEEEVKSGAAYVLFYRRV 283 H G+M G Y AY+ K D + W N D++V ++ E+V AY+LFY R+ Sbjct: 899 HSGTMRGGHYVAYVRGGQRVKETDSSSTAWYNVSDAYVRQVSLEKVLHSEAYILFYERI 957
>UBP5_YEAST (P39944) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) Length = 805 Score = 39.7 bits (91), Expect = 0.003 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAIN-EEEVKSGAAYVLFYRRV 283 V+ H GS+ G YT+Y+ + W FDDS I E + +AYVLFY R+ Sbjct: 750 VACHSGSLYGGHYTSYVYKGPKKGWYFFDDSLYRPITFSTEFITPSAYVLFYERI 804
>UBP49_HUMAN (Q70CQ1) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 688 Score = 39.7 bits (91), Expect = 0.003 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 2/80 (2%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVTEADGA 265 V +H SG YTAY + W + +DS ++ + EEV AY+LFY + T A Sbjct: 604 VMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQGNA 663 Query: 264 ASNGT--QSCVKRSRRSSQR 211 + T Q+ V+ S R Sbjct: 664 RISETHLQAQVQSSNNDEGR 683
>UBP22_MOUSE (Q5DU02) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 39.7 bits (91), Expect = 0.003 Identities = 17/53 (32%), Positives = 33/53 (62%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 V NH G++ SG YT++I+ +++W DD+ ++ + ++V Y+LFY + Sbjct: 468 VVNHQGTLESGHYTSFIR-QHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHK 519
>UBP22_HUMAN (Q9UPT9) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 39.7 bits (91), Expect = 0.003 Identities = 17/53 (32%), Positives = 33/53 (62%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 V NH G++ SG YT++I+ +++W DD+ ++ + ++V Y+LFY + Sbjct: 468 VVNHQGTLESGHYTSFIR-QHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHK 519
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 39.3 bits (90), Expect = 0.004 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 H G++ +G Y AY +N+W DD+ + + E EV + AY+LFY Sbjct: 387 HKGTLDTGHYIAYTYY--QNQWFLLDDTTIVEVKESEVLNSQAYLLFY 432
>UBP10_YEAST (P53874) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) Length = 792 Score = 38.9 bits (89), Expect = 0.006 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Frame = -3 Query: 426 SMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV-KSGAAYVLFYRRVT 280 S++SG Y A+ K D + W+ +DD +++ I+E +V K AY L Y R+T Sbjct: 686 SLSSGHYIAHCKQPDGS-WATYDDEYINIISERDVLKEPNAYYLLYTRLT 734
>UBP14_CAEEL (Q17361) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 489 Score = 38.5 bits (88), Expect = 0.008 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 8/59 (13%) Frame = -3 Query: 444 VSNHYG-SMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV--KSG-----AAYVLFY 292 + H G S G Y A+++ ++ +W FDD HV+ ++EE + SG +AYVL Y Sbjct: 397 IITHKGRSSQDGHYVAWMRSSEDGKWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLY 455
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 38.5 bits (88), Expect = 0.008 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 9/61 (14%) Frame = -3 Query: 444 VSNHYGSMA-SGQYTAYIK-LLDENRWSNFDDSHVSAINEEEV-------KSGAAYVLFY 292 V H G+ + SG Y A+I+ LDEN+W F+D VS + +E++ +S +A +L Y Sbjct: 435 VITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSALILMY 494 Query: 291 R 289 + Sbjct: 495 K 495
>UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 798 Score = 38.1 bits (87), Expect = 0.010 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV----KSGAAYVLFYRRV 283 V +H S G YT + + N W DD V IN+ +V AY+L+YRRV Sbjct: 738 VYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRV 795
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 38.1 bits (87), Expect = 0.010 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 13/67 (19%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYI-KLLDEN------RWSNFDDSHVSAINEE------EVKSGAAY 304 V NH G++ SG YT+ + K L+ N +W FDD V A + ++ S Y Sbjct: 1003 VVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVY 1062 Query: 303 VLFYRRV 283 VLFY RV Sbjct: 1063 VLFYERV 1069
>UBP10_MOUSE (P52479) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 792 Score = 38.1 bits (87), Expect = 0.010 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV----KSGAAYVLFYRRV 283 V +H S G YT + + N W DD V IN+ +V AY+L+YRRV Sbjct: 732 VYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPPADRTAYLLYYRRV 789
>UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.1.2.15)| (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Deubiquitinating enzyme 30) Length = 517 Score = 37.7 bits (86), Expect = 0.013 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 8/59 (13%) Frame = -3 Query: 435 HYGSMASGQYTAYIK--------LLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRV 283 H+G M SG + Y + L N+W D V + +EV S +AY+LFY RV Sbjct: 444 HHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERV 502
>UBP1_ARATH (Q9FPT5) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) (AtUBP1) Length = 1083 Score = 37.7 bits (86), Expect = 0.013 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 12/63 (19%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENR------------WSNFDDSHVSAINEEEVKSGAAYVLFY 292 H G+M+ G Y +YI+ + R W + DS V + EEV AY+LFY Sbjct: 1021 HLGAMSRGHYVSYIRGGHKERRDSDTKEPNSSIWYHASDSQVRPASLEEVLRSEAYILFY 1080 Query: 291 RRV 283 R+ Sbjct: 1081 ERI 1083
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 37.0 bits (84), Expect = 0.022 Identities = 16/53 (30%), Positives = 30/53 (56%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 +S H G ++ G Y Y K +W ++DS ++ +E+ + +AY+LFY + Sbjct: 1317 ISCHSGILSGGHYITYAKN-PNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQ 1368
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 37.0 bits (84), Expect = 0.022 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = -3 Query: 444 VSNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 +S H G + G Y Y K +W ++DS ++ +E+ + +AY+LFY + Sbjct: 1515 ISCHSGILGGGHYVTYAKN-PNCKWYCYNDSSCKELHPDEIDTDSAYILFYEQ 1566
>UBP3_SCHPO (O94269) Probable ubiquitin carboxyl-terminal hydrolase 3 (EC| 3.1.2.15) (Ubiquitin thioesterase 3) (Ubiquitin-specific processing protease 3) (Deubiquitinating enzyme 3) Length = 512 Score = 36.2 bits (82), Expect = 0.038 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 17/67 (25%) Frame = -3 Query: 435 HYGSMASG-QYTAYIKLLDENRWSNFDDSHVSAINEEEVKSG----------------AA 307 H+G+ ASG YT ++ LD++ W DD+H+ + +V++ A Sbjct: 444 HHGTSASGGHYTVDVQQLDKSGWFRIDDTHIHRVPIHDVENSELSADPSLSKLGHGDRVA 503 Query: 306 YVLFYRR 286 Y+LFY R Sbjct: 504 YLLFYTR 510
>UBP11_YEAST (P36026) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 717 Score = 35.8 bits (81), Expect = 0.049 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 16/70 (22%) Frame = -3 Query: 438 NHYGSMASGQYTAYIKL-------LDENRWSNFDDSHVSAINEE---------EVKSGAA 307 NH G++ +G YT+ + L+ W FDD ++ ++ E+ S Sbjct: 640 NHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEV 699 Query: 306 YVLFYRRVTE 277 YVLFY R+ E Sbjct: 700 YVLFYERMDE 709
>UBP3_YEAST (Q01477) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 912 Score = 34.7 bits (78), Expect = 0.11 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 9/59 (15%) Frame = -3 Query: 435 HYG-SMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSG--------AAYVLFYRR 286 H+G S G YTA + + N+W DD +++ + +++V G AY+L Y++ Sbjct: 852 HHGVSSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLKGGEEASDSRTAYILMYQK 910
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 33.9 bits (76), Expect = 0.19 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = -3 Query: 426 SMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRV 283 S +G Y Y+K +W +DS V + N + V + AYVLFY R+ Sbjct: 377 SCHAGHYYCYVKA-SNGQWYQMNDSLVHSSNVKVVLNQQAYVLFYLRI 423
>UBP14_HUMAN (P54578) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 493 Score = 33.1 bits (74), Expect = 0.32 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 10/64 (15%) Frame = -3 Query: 444 VSNHYG-SMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV--KSGA-----AYVLFY- 292 V H G S +SG Y +++K ++ W FDD VS + E++ SG AYVL Y Sbjct: 422 VLTHQGRSSSSGHYVSWVKR-KQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYG 480 Query: 291 -RRV 283 RRV Sbjct: 481 PRRV 484
>UBP7_SCHPO (Q9P7S5) Probable ubiquitin carboxyl-terminal hydrolase 7 (EC| 3.1.2.15) (Ubiquitin thioesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) Length = 875 Score = 33.1 bits (74), Expect = 0.32 Identities = 23/72 (31%), Positives = 30/72 (41%), Gaps = 21/72 (29%) Frame = -3 Query: 435 HYGSMASGQYTAYI---KLLD------------------ENRWSNFDDSHVSAINEEEVK 319 H G++ G Y AY+ K LD E RW D+ V + +EV Sbjct: 804 HSGTLNYGHYVAYVLSHKFLDLSAPSTNSKDFRSEAGIPERRWLYISDNIVRESSWDEVS 863 Query: 318 SGAAYVLFYRRV 283 AY+LFY RV Sbjct: 864 KVEAYMLFYERV 875
>UBP14_PANTR (P60051) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 33.1 bits (74), Expect = 0.32 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 10/64 (15%) Frame = -3 Query: 444 VSNHYG-SMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV--KSGA-----AYVLFY- 292 V H G S +SG Y +++K ++ W FDD VS + E++ SG AYVL Y Sbjct: 422 VLTHQGRSSSSGHYVSWVKR-KQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYG 480 Query: 291 -RRV 283 RRV Sbjct: 481 PRRV 484
>UBP18_HUMAN (Q9UMW8) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) (hUBP43) Length = 372 Score = 32.7 bits (73), Expect = 0.42 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 10/61 (16%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVK----------SGAAYVLFYRR 286 H G SG Y YI+ + +W F+DS++ ++ E+++ AY+L Y + Sbjct: 310 HVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQETAYLLVYMK 369 Query: 285 V 283 + Sbjct: 370 M 370
>UBPA_DICDI (P54201) Ubiquitin carboxyl-terminal hydrolase A (EC 3.1.2.15)| (Ubiquitin thioesterase A) (Ubiquitin-specific-processing protease A) (Deubiquitinating enzyme A) Length = 837 Score = 32.7 bits (73), Expect = 0.42 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = -3 Query: 438 NHYGS-MASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 +H G+ + G Y +IK NRW F+D HV E+ Y+ FY+R Sbjct: 787 SHLGNNVTCGHYVCHIK--KNNRWIKFNDRHVQL--SEQPPKELGYIYFYKR 834
>UBP14_RABIT (P40826) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 32.3 bits (72), Expect = 0.55 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 10/64 (15%) Frame = -3 Query: 444 VSNHYG-SMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV--KSGA-----AYVLFY- 292 V H G S +SG Y +++K + W FDD VS + E++ SG AYVL Y Sbjct: 421 VLTHQGRSSSSGHYVSWVKR-KHDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYG 479 Query: 291 -RRV 283 RRV Sbjct: 480 PRRV 483
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 32.0 bits (71), Expect = 0.71 Identities = 19/44 (43%), Positives = 22/44 (50%) Frame = -3 Query: 417 SGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRR 286 +G Y YIK W +DS VS + V S AYVLFY R Sbjct: 369 AGHYFCYIKA-SNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIR 411
>UBP14_MOUSE (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 32.0 bits (71), Expect = 0.71 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 10/64 (15%) Frame = -3 Query: 444 VSNHYG-SMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV--KSGA-----AYVLFY- 292 V H G S +SG Y ++++ ++ W FDD VS + E++ SG AYVL Y Sbjct: 421 VLTHQGRSSSSGHYVSWVRR-KQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYG 479 Query: 291 -RRV 283 RRV Sbjct: 480 PRRV 483
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 31.6 bits (70), Expect = 0.93 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEE 325 H G G Y Y+ + +W FDD VS +EE Sbjct: 456 HSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEE 492
>UBP18_MOUSE (Q9WTV6) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) Length = 368 Score = 31.6 bits (70), Expect = 0.93 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVK 319 H G G Y AYI+ + +W F+DSHV + ++V+ Sbjct: 306 HVGMADFGHYCAYIRNPVDGKWFCFNDSHVCWVTWKDVQ 344
>MOR2_SCHPO (Q9HDV6) Cell polarity protein mor2 (Morphological round protein 2)| Length = 2196 Score = 31.2 bits (69), Expect = 1.2 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = -3 Query: 393 KLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVTEADGAASNGTQSCVKRSR 226 +L W++ D VS INE+ V+ + +Y T G+ SN + + RSR Sbjct: 2138 ELKQNKNWNSMLDQSVSMINEDSVEDHETHENYYHLRTMFQGSESNESFTDTTRSR 2193
>UBP15_YEAST (P50101) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 1230 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV 322 H G +++G Y IK E++W FDD V + +++V Sbjct: 457 HSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQV 494
>UBP25_HUMAN (Q9UHP3) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (USP on chromosome 21) Length = 1087 Score = 30.8 bits (68), Expect = 1.6 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 8/56 (14%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV--------KSGAAYVLFY 292 H G +G Y AYI E+RW ++D V+ + EE+ ++ +AY L Y Sbjct: 599 HEGQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMY 654
>UBP25_MOUSE (P57080) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (mUSP25) Length = 1055 Score = 30.8 bits (68), Expect = 1.6 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 8/56 (14%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV--------KSGAAYVLFY 292 H G +G Y AYI E+RW ++D V+ + EE+ ++ +AY L Y Sbjct: 600 HEGQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMY 655
>UBP2_SCHPO (Q9P3U0) Probable ubiquitin carboxyl-terminal hydrolase 2 (EC| 3.1.2.15) (Ubiquitin thioesterase 2) (Ubiquitin-specific processing protease 2) (Deubiquitinating enzyme 2) Length = 1141 Score = 30.4 bits (67), Expect = 2.1 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV 322 H G + G Y YI + N + ++D +V+ ++E E+ Sbjct: 1068 HRGQASFGHYWTYIHDFENNVYRKYNDEYVTVVDESEI 1105
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 30.4 bits (67), Expect = 2.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV 322 H G + G Y A IK ++ W FDD V+ +EV Sbjct: 473 HGGDLHGGHYYALIKPEKDSNWFKFDDDRVTRATIKEV 510
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 30.0 bits (66), Expect = 2.7 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 9/81 (11%) Frame = -3 Query: 429 GSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVK--------SGAAYVLFYRRVTEA 274 G G Y + ++ W FDD +V+ +NE ++ AYVLFY E Sbjct: 369 GGPHRGHYVSIVRTKTYG-WVLFDDENVTPVNENYLQRFFGDQPGQATAYVLFYTAADEE 427 Query: 273 DGAASN-GTQSCVKRSRRSSQ 214 D S T+ +K SQ Sbjct: 428 DDDVSEVDTKESIKPMSIPSQ 448
>IE63_HCMVA (P16749) Transcriptional regulator IE63 homolog (Protein UL69)| Length = 744 Score = 29.6 bits (65), Expect = 3.5 Identities = 18/64 (28%), Positives = 33/64 (51%) Frame = -3 Query: 441 SNHYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRVTEADGAA 262 +NH+GS A Q + L+D+ + A++E+E++ + + +R GAA Sbjct: 192 NNHHGSSAGPQQQQMLALIDDE---------LDAMDEDELQQLSRLIEKKKRARLQRGAA 242 Query: 261 SNGT 250 S+GT Sbjct: 243 SSGT 246
>YIJ7_YEAST (P40492) Hypothetical 59.9 kDa protein in SGA1-KTR7 intergenic| region Length = 516 Score = 29.3 bits (64), Expect = 4.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 426 SMASGQYTAYIKLLDENRWSNFDDSHVS 343 ++ SG + Y+ LLD+ RWS +D +S Sbjct: 338 NLQSGDFERYLNLLDDQRWSVLNDLFLS 365
>UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrolase 5 (EC| 3.1.2.15) (Ubiquitin thioesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) Length = 1108 Score = 28.9 bits (63), Expect = 6.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -3 Query: 435 HYGSMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEV 322 H G + +G Y A +K + W +DD+ V+ EV Sbjct: 456 HSGDLHNGHYYALLKTEKDGPWYKYDDTRVTRATLREV 493
>UBP35_HUMAN (Q9P2H5) Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)| (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35) (Deubiquitinating enzyme 35) Length = 1017 Score = 28.9 bits (63), Expect = 6.0 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 7/39 (17%) Frame = -3 Query: 381 ENRWSNFDDSHVSAINEEEVKS-------GAAYVLFYRR 286 EN+W F+D+ VS + E V + AYVLFYR+ Sbjct: 886 ENQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYRQ 924
>NPW_PIG (Q8MI35) Neuropeptide W precursor (Preproprotein L8) (PPL8)| [Contains: Neuropeptide W-23 (NPW23) (L8); Neuropeptide W-30 (NPW30) (L8C)] Length = 152 Score = 28.9 bits (63), Expect = 6.0 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 63 LLIVFLTPFPSKLYSRNILWSHTETLQFHTQKGTKGVLLKLRR 191 LL++ L P P++ + + HT + ++HT G+L+ LRR Sbjct: 20 LLLLLLLPLPARAW-----YKHTASPRYHTVGRAAGLLMGLRR 57
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 28.5 bits (62), Expect = 7.9 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 417 SGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFY 292 SG Y +K +W DD+ V+ + V + AYVLFY Sbjct: 305 SGHYFCCVKA-GHGKWYKMDDTKVTRCDVTSVLNENAYVLFY 345
>UBP14_ARATH (Q8L6Y1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (AtUBP14) (TITAN-6 protein) Length = 797 Score = 28.5 bits (62), Expect = 7.9 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -3 Query: 444 VSNHYG-SMASGQYTAYIKLLDENRWSNFDDSHVSAINEEEVKSGAAYVLFYRRV 283 + +H G S+ G Y A+I L E RW F+D V + G YV F++R+ Sbjct: 746 IVSHMGTSVHCGHYVAHI--LKEGRWVIFNDDKVGISTDPPKDMG--YVYFFQRL 796 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,007,476 Number of Sequences: 219361 Number of extensions: 1358304 Number of successful extensions: 4398 Number of sequences better than 10.0: 77 Number of HSP's better than 10.0 without gapping: 4307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4382 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
