Clone Name | rbastl04d04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CRUM1_MOUSE (Q8VHS2) Crumbs homolog 1 precursor | 29 | 3.1 | 2 | CFTR_CARPS (Q2QLC5) Cystic fibrosis transmembrane conductance re... | 28 | 4.0 | 3 | HXA9_HETFR (Q9IA26) Homeobox protein Hox-A9 | 28 | 6.9 | 4 | MTH10_DROME (Q9W0R5) Probable G-protein coupled receptor Mth-lik... | 28 | 6.9 | 5 | MTH2_DROSI (Q95NQ0) G-protein coupled receptor Mth2 precursor (P... | 28 | 6.9 | 6 | FTSK_LISMO (Q8Y7A3) DNA translocase ftsK | 27 | 9.0 |
---|
>CRUM1_MOUSE (Q8VHS2) Crumbs homolog 1 precursor| Length = 1405 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 318 HSKAICEHKAIMYICHCPTPYT 383 H+ A CE YICHC YT Sbjct: 310 HNDATCEDTVDSYICHCRPGYT 331
>CFTR_CARPS (Q2QLC5) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1482 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 210 MVHILLTTSNLLHHRSSTSLVLHNLLH 290 +VH L+T S +LHH+ +LH++LH Sbjct: 938 LVHSLITVSKILHHK-----MLHSVLH 959
>HXA9_HETFR (Q9IA26) Homeobox protein Hox-A9| Length = 260 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 109 FVSKSSYVVTSWSAKMARTKGNVPLQTHP 195 F SK++ TSWS A++ N+P HP Sbjct: 53 FQSKATVFSTSWSPVHAQSSANMPTVYHP 81
>MTH10_DROME (Q9W0R5) Probable G-protein coupled receptor Mth-like 10 precursor| (Protein methuselah-like 10) Length = 575 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 15 LPCNLYIMINTRHHNLWFS*SYNFYLYTLP 104 +PCN Y +N H L+ + SY++Y +P Sbjct: 54 VPCNFYDTVNLTGHRLFPNGSYDYYGTIVP 83
>MTH2_DROSI (Q95NQ0) G-protein coupled receptor Mth2 precursor (Protein| methuselah-2) Length = 536 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 15 LPCNLYIMINTRHHNLWFS*SYNFYLYTLP 104 +PCN Y +N H L+ + SY++Y +P Sbjct: 15 VPCNFYDTVNLTGHRLFPNGSYDYYGTIVP 44
>FTSK_LISMO (Q8Y7A3) DNA translocase ftsK| Length = 757 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = -3 Query: 235 LVVKRICTIYQIIRGVSVMVHYLWFLPSLPTKMSPHSLTWRQTFGRVYK 89 L KR+ IY I+ G +H + + +L S S TW+ +++ Sbjct: 88 LFSKRLVGIYLIVLGFLTYIHMYFIIHNLGANASVVSSTWKLVLENLFR 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,204,375 Number of Sequences: 219361 Number of extensions: 1259849 Number of successful extensions: 3700 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3700 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)