| Clone Name | rbastl04c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GIDA_PELUB (Q4FNR6) tRNA uridine 5-carboxymethylaminomethyl modi... | 30 | 2.1 | 2 | CUT9_SCHPO (P41889) 20S cyclosome/APC complex protein cut9 (Cell... | 28 | 6.2 | 3 | CSD_PSEPK (Q9Z408) Probable cysteine desulfurase (EC 2.8.1.7) | 28 | 8.1 |
|---|
>GIDA_PELUB (Q4FNR6) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 623 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 41 TANKVLCGKIVETRAKSLNGLLLLQDNKNI*NRYRK 148 + K+LCGK++ T LNGL+ + D + R+ + Sbjct: 142 SGKKILCGKLILTTGTFLNGLIHIGDERTPAGRFNE 177
>CUT9_SCHPO (P41889) 20S cyclosome/APC complex protein cut9 (Cell untimely torn| protein 9) Length = 671 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +3 Query: 111 YRIIKIYEIGTEKTHPAVQLSTGNGILMSSIELHYI--LVPTLTLAHRH 251 YR +K+Y+ + + + LST + + ++I L Y+ +P L + H H Sbjct: 526 YRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLH 574
>CSD_PSEPK (Q9Z408) Probable cysteine desulfurase (EC 2.8.1.7)| Length = 401 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 165 QLSTGNGILMSSIELHYILVPTLTLAHRHRQH 260 +L G+ I +S++E H L+P LAHR H Sbjct: 106 RLEAGDEIAISALEHHANLLPWQQLAHRRNLH 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,491,328 Number of Sequences: 219361 Number of extensions: 656340 Number of successful extensions: 1794 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1794 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)