| Clone Name | rbastl04b01 |
|---|---|
| Clone Library Name | barley_pub |
>UBP14_ARATH (Q8L6Y1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (AtUBP14) (TITAN-6 protein) Length = 797 Score = 85.1 bits (209), Expect = 1e-16 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 383 VSHMGTS HCGHYVAHILK+GRW IFND+KV S D PKDMGY+Y Sbjct: 747 VSHMGTSVHCGHYVAHILKEGRWVIFNDDKVGISTDPPKDMGYVY 791
>UBP5_MOUSE (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 77.4 bits (189), Expect = 2e-14 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -3 Query: 520 FVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 383 F+SHMGTST CGHYV HI K+GRW I+ND KV AS PKD+GY+Y Sbjct: 806 FISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIY 851
>UBP5_HUMAN (P45974) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 77.4 bits (189), Expect = 2e-14 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -3 Query: 520 FVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 383 F+SHMGTST CGHYV HI K+GRW I+ND KV AS PKD+GY+Y Sbjct: 806 FISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIY 851
>UBP13_HUMAN (Q92995) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) Length = 863 Score = 73.2 bits (178), Expect = 4e-13 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 520 FVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 383 F+SHMGTST GHY+ HI K+GRW I+ND+KV AS PKD+GY+Y Sbjct: 811 FISHMGTSTMSGHYICHIKKEGRWVIYNDHKVCASERPPKDLGYMY 856
>UBPA_DICDI (P54201) Ubiquitin carboxyl-terminal hydrolase A (EC 3.1.2.15)| (Ubiquitin thioesterase A) (Ubiquitin-specific-processing protease A) (Deubiquitinating enzyme A) Length = 837 Score = 60.8 bits (146), Expect = 2e-09 Identities = 24/46 (52%), Positives = 31/46 (67%) Frame = -3 Query: 520 FVSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAASVDLPKDMGYLY 383 F+SH+G + CGHYV HI K+ RW FND V S PK++GY+Y Sbjct: 785 FISHLGNNVTCGHYVCHIKKNNRWIKFNDRHVQLSEQPPKELGYIY 830
>UBP14_SCHPO (Q11119) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (UBA-domain-containing protein 2) Length = 775 Score = 48.5 bits (114), Expect = 1e-05 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 6/51 (11%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILK--DGR--WTIFNDNKV--AASVDLPKDMGYLY 383 +SH G+S H GHYVA I K DG+ W +FND KV AS++ K GY+Y Sbjct: 719 ISHKGSSAHAGHYVAFIRKEIDGKQQWVLFNDEKVLQVASLEEAKTTGYVY 769
>UBP14_YEAST (P38237) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (Glucose-induced degradation protein 6) Length = 803 Score = 40.4 bits (93), Expect = 0.003 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILK----DGRWTIFNDNKVAA--SVDLPKDMGYLY 383 + H G S H GHYV I K +W ++ND K+ A S++ K GY+Y Sbjct: 748 ICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAADSIEDMKKNGYIY 798
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 35.4 bits (80), Expect = 0.096 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILKDGRWTIFNDNKVAAS 416 V H G+ GHY A+ + +GRW FND+ V + Sbjct: 460 VVHHGSGVGSGHYTAYAVHEGRWFHFNDSTVTVT 493
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 34.3 bits (77), Expect = 0.21 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 425 V H G+ GHY A+ +GRW FND+ V Sbjct: 461 VVHHGSGVGSGHYTAYATHEGRWFHFNDSTV 491
>UBP14_CAEEL (Q17361) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 489 Score = 33.1 bits (74), Expect = 0.48 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHI--LKDGRWTIFNDNKV 425 ++H G S+ GHYVA + +DG+W +F+D V Sbjct: 398 ITHKGRSSQDGHYVAWMRSSEDGKWRLFDDEHV 430
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 32.7 bits (73), Expect = 0.62 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHI---LKDGRWTIFNDNKVA 422 ++H G ++ GHY A I L + +W FND+KV+ Sbjct: 436 ITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470
>ATG1_CANGA (Q6FL58) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) Length = 942 Score = 32.0 bits (71), Expect = 1.1 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -2 Query: 200 FRRYALATSVTFMLSTM*LFMQSEWLCFESYNLSAPRWFPLVGILFEHCC 51 F R+ +TS+ L L+M E L ++ YN A W + +LFE CC Sbjct: 201 FARFLPSTSLAETLCGSPLYMAPEILNYQKYNAKADLW-SVGTVLFEMCC 249
>UBP37_HUMAN (Q86T82) Ubiquitin carboxyl-terminal hydrolase 37 (EC 3.1.2.15)| (Ubiquitin thioesterase 37) (Ubiquitin-specific-processing protease 37) (Deubiquitinating enzyme 37) Length = 979 Score = 32.0 bits (71), Expect = 1.1 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 7/52 (13%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHI--LKDGRWTIFNDNKVA----ASVDLPKD-MGYLY 383 VSH+G+++ GHY++ + +K W +ND +V+ A+V +D GY++ Sbjct: 895 VSHIGSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYIF 946
>UBP14_PANTR (P60051) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 31.6 bits (70), Expect = 1.4 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAASVDLPKDM 395 ++H G S+ GHYV+ + K W F+D+KV S+ P+D+ Sbjct: 423 LTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKV--SIVTPEDI 462
>UBP14_MOUSE (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 31.6 bits (70), Expect = 1.4 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAASVDLPKDM 395 ++H G S+ GHYV+ + K W F+D+KV S+ P+D+ Sbjct: 422 LTHQGRSSSSGHYVSWVRRKQDEWIKFDDDKV--SIVTPEDI 461
>UBP14_HUMAN (P54578) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 493 Score = 31.6 bits (70), Expect = 1.4 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAASVDLPKDM 395 ++H G S+ GHYV+ + K W F+D+KV S+ P+D+ Sbjct: 423 LTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKV--SIVTPEDI 462
>UBP14_RABIT (P40826) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 31.2 bits (69), Expect = 1.8 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAASVDLPKDM 395 ++H G S+ GHYV+ + K W F+D+KV S+ P+D+ Sbjct: 422 LTHQGRSSSSGHYVSWVKRKHDEWIKFDDDKV--SIVTPEDI 461
>UBP10_YEAST (P53874) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) Length = 792 Score = 30.8 bits (68), Expect = 2.4 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILK-DGRWTIFNDNKV 425 V H G S GHY+AH + DG W ++D + Sbjct: 680 VVHEGRSLSSGHYIAHCKQPDGSWATYDDEYI 711
>UBP29_MOUSE (Q9ES63) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 869 Score = 30.4 bits (67), Expect = 3.1 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHI--LKDGRWTIFNDNKVAASVD 410 VSH G+S + GHYV+ + + W +++D +V S D Sbjct: 770 VSHFGSSPNSGHYVSDVYDFQKQAWLLYSDVQVFESSD 807
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 30.4 bits (67), Expect = 3.1 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHI-LKDGRWTIFNDNKVA--ASVDLPKDMGYL 386 VSH GT GHY+A + G+W FND+ V+ + ++ K+ YL Sbjct: 417 VSHKGTVNE-GHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYL 462
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 30.0 bits (66), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 511 HMGTSTHCGHYVAHI-LKDGRWTIFNDNKVAAS 416 H G S H GHY ++ +G+W ND+ V +S Sbjct: 373 HSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSS 405
>ATG1_KLULA (Q6CSX2) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) Length = 831 Score = 29.6 bits (65), Expect = 5.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -2 Query: 200 FRRYALATSVTFMLSTM*LFMQSEWLCFESYNLSAPRWFPLVGILFEHCC 51 F R+ TS+ L L+M E L ++ YN A W + +L+E CC Sbjct: 210 FARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLW-SVGTVLYEMCC 258
>ATG1_YEAST (P53104) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) (Autophagy protein 3) (Cytoplasm to vacuole targeting protein 10) Length = 897 Score = 29.6 bits (65), Expect = 5.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -2 Query: 200 FRRYALATSVTFMLSTM*LFMQSEWLCFESYNLSAPRWFPLVGILFEHCC 51 F R+ TS+ L L+M E L ++ YN A W + ++FE CC Sbjct: 214 FARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLW-SVGTVVFEMCC 262
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 29.6 bits (65), Expect = 5.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 425 V H+G+ + GHYV+ + W F+D V Sbjct: 304 VVHVGSGPNHGHYVSLVKSHNHWLFFDDENV 334
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 29.6 bits (65), Expect = 5.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 425 V H+G+ + GHYV+ + W F+D V Sbjct: 299 VVHVGSGPNHGHYVSLVKSHNHWLFFDDESV 329
>ATG1_ASHGO (Q75CH3) Serine/threonine-protein kinase ATG1 (EC 2.7.11.1)| (Autophagy-related protein 1) Length = 972 Score = 29.6 bits (65), Expect = 5.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -2 Query: 200 FRRYALATSVTFMLSTM*LFMQSEWLCFESYNLSAPRWFPLVGILFEHCC 51 F R+ TS+ L L+M E L ++ YN A W + +L+E CC Sbjct: 208 FARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLW-SVGTVLYEMCC 256
>UBP46_MOUSE (P62069) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 29.3 bits (64), Expect = 6.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 425 V H G+ + GHY+ + G W +F+D+ V Sbjct: 302 VVHCGSGPNRGHYITIVKSHGFWLLFDDDIV 332
>UBP46_HUMAN (P62068) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 29.3 bits (64), Expect = 6.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILKDGRWTIFNDNKV 425 V H G+ + GHY+ + G W +F+D+ V Sbjct: 302 VVHCGSGPNRGHYITIVKSHGFWLLFDDDIV 332
>UBP18_MOUSE (Q9WTV6) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) Length = 368 Score = 29.3 bits (64), Expect = 6.9 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -3 Query: 517 VSHMGTSTHCGHYVAHILK--DGRWTIFNDNKV 425 ++H+G + GHY A+I DG+W FND+ V Sbjct: 304 IAHVGMADF-GHYCAYIRNPVDGKWFCFNDSHV 335
>PITM2_MOUSE (Q6ZPQ6) Membrane-associated phosphatidylinositol transfer protein| 2 (Phosphatidylinositol transfer protein, membrane-associated 2) (Pyk2 N-terminal domain-interacting receptor 3) (NIR-3) (Drosophila retinal degeneration B homolog 2) (RdgB2) Length = 1335 Score = 29.3 bits (64), Expect = 6.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 224 ISLETSTSGCGEMVASSQICTKSPSTIRHAP 316 IS+ + SG E +S I K PS++ H P Sbjct: 822 ISIASQVSGMAESYTASSIAQKGPSSLNHTP 852
>RIR1_SYNY3 (P74240) Ribonucleoside-diphosphate reductase alpha subunit (EC| 1.17.4.1) (Ribonucleotide reductase) Length = 767 Score = 28.9 bits (63), Expect = 9.0 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -3 Query: 514 SHMGTS--THCGHYVAHILKDGRWTIFNDNKVAASVD 410 +H GTS +H GH + I +DG T N K+ A VD Sbjct: 17 AHAGTSQGSHQGHRIQVIRRDGSSTPLNIGKIRAVVD 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,926,620 Number of Sequences: 219361 Number of extensions: 1684316 Number of successful extensions: 3858 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 3772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3853 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)