Clone Name | rbastl04a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YL100_MIMIV (Q5UPH0) Putative ankyrin repeat protein L100 | 28 | 9.1 |
---|
>YL100_MIMIV (Q5UPH0) Putative ankyrin repeat protein L100| Length = 602 Score = 28.5 bits (62), Expect = 9.1 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -2 Query: 189 EKMY--ILRIDKQKPDHFDPFIPYRHMTETFQEWSACSPDR 73 +K+Y ILR DK DH ++P + E FQ +C P R Sbjct: 3 QKIYFKILRFDKTHNDHV--YLPGENSVENFQTEGSCVPGR 41 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,196,053 Number of Sequences: 219361 Number of extensions: 1691095 Number of successful extensions: 3915 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3913 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)