Clone Name | rbastl03h12 |
---|---|
Clone Library Name | barley_pub |
>BMS1_HUMAN (Q14692) Ribosome biogenesis protein BMS1 homolog| Length = 1282 Score = 40.8 bits (94), Expect = 8e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -1 Query: 392 ATEGIARCTFEDKVLMSDIVFMRAW 318 A EG R +FEDK+LMSDIVFMR W Sbjct: 1077 APEGAFRASFEDKLLMSDIVFMRTW 1101
>BMS1_SCHPO (O94653) Ribosome biogenesis protein BMS1 homolog| Length = 1121 Score = 40.0 bits (92), Expect = 0.001 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = -1 Query: 383 GIARCTFEDKVLMSDIVFMRAWVCL-----CTVVPVR*STSQDALPTQDTSPHWHGWQQT 219 G R TFEDK+LMSDIVF+RAW + CT+V + L T T W+G + T Sbjct: 923 GHFRATFEDKILMSDIVFLRAWYPVQVRKFCTMV-------TNLLETDKT--EWNGMRLT 973
>BMS1_YEAST (Q08965) Ribosome biogenesis protein BMS1| Length = 1183 Score = 36.2 bits (82), Expect = 0.019 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -1 Query: 386 EGIARCTFEDKVLMSDIVFMRAW 318 EG R FEDK+LMSDIV +R+W Sbjct: 984 EGHYRAAFEDKILMSDIVILRSW 1006
>MYO2_CAEEL (P12845) Myosin-2 (Myosin heavy chain C) (MHC C)| Length = 1947 Score = 30.8 bits (68), Expect = 0.80 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = -3 Query: 276 PGRTAYPRHVTPLARLAADDS*TFSTD*LEMHVILLVTLAKEK 148 P RT +P V A LAAD+S TD + ++L L KEK Sbjct: 723 PNRTLHPDFVQRYALLAADESIIGKTDAKKGSALMLARLVKEK 765
>NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| [Contains: Transforming protein Int-3; Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 1964 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = -2 Query: 265 CLPKTRHPTGTAGSRRLMNL*Y-----GLVGDACDIASHSRKRERCGN*G 131 CL + HP+GTA L N Y G G C++ + + C N G Sbjct: 1006 CLDRPCHPSGTAACHSLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGG 1055
>DPO4_VIBPA (Q87MB4) DNA polymerase IV (EC 2.7.7.7) (Pol IV)| Length = 354 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 29 SLNFSTYDVSWSLMDDKIYISTEVYAYRLNMVSP 130 S N STYD W ++++K+Y E RL SP Sbjct: 254 SQNISTYDECWQVIEEKLYPELE---KRLERASP 284
>DPH1_NEUCR (Q7SC98) Diphthamide biosynthesis protein 1| Length = 459 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 249 RVLGRQCVLAGASSDGNDSAKTDPCSHEDNVTHKNFVLKCAPRNAFR 389 R LGRQ AG SS + ++ + P ++ + PR A R Sbjct: 35 RFLGRQSAAAGKSSSSSSNSTSQPAGANTSIEDSGAIQVAQPRRAPR 81
>TBX5_RAT (Q5I2P1) T-box transcription factor TBX5 (T-box protein 5)| Length = 517 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 273 LAGASSDGNDSAKTDPCSHEDNVTHKNFVLKCAPRNAFRS 392 LAG ++ G+ H+ +VTH+ V +C P+ +S Sbjct: 438 LAGMANHGSPQLGEGMFQHQTSVTHQPVVRQCGPQTGLQS 477
>PIG1_YEAST (Q06216) Serine/threonine-protein phosphatase 1 regulatory subunit| PIG1 Length = 648 Score = 28.1 bits (61), Expect = 5.2 Identities = 20/64 (31%), Positives = 34/64 (53%) Frame = +2 Query: 2 TKQNWPTVLSLNFSTYDVSWSLMDDKIYISTEVYAYRLNMVSPALVTTSFSFARVTSNIT 181 T NW + +N + Y+ S + D+ ++ A +LN++S L+ T+F F R T T Sbjct: 244 TLNNWADIHYIN-AHYNKSVTPHVDEFKFIIDISALKLNLISKNLIYTNF-FERKT---T 298 Query: 182 CISN 193 C+ N Sbjct: 299 CLLN 302
>RGMB_MOUSE (Q7TQ33) RGM domain family member B precursor| Length = 436 Score = 27.3 bits (59), Expect = 8.9 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 5/70 (7%) Frame = +1 Query: 19 NCSVSQLFNIRCKLVTHG*QNLHKHGGIRLSVKHGVTGPSYHIFLFCESD*QYHM----- 183 NCS + VTH N H HGG+R +HG +LFC H+ Sbjct: 123 NCSKDGPTSSTNPEVTHDPCNYHSHGGVR---EHGGGDQRPPNYLFCGLFGDPHLRTFKD 179 Query: 184 HLQLIRTKGS 213 H Q + +G+ Sbjct: 180 HFQTCKVEGA 189
>BGAM_LEULA (Q02604) Beta-galactosidase small subunit (EC 3.2.1.23) (Lactase)| Length = 319 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = -2 Query: 373 GAHLRTKFL*VTLSSCEHGS-----VFALSFPSDEAPARTHCLPKT 251 G H++T+ + VT S+ ++ + F+L+F +AP CLP T Sbjct: 214 GMHMQTEQVTVTRSTTQNNADHDNTPFSLTFSQTDAPFAFSCLPYT 259
>OPGH_SHEON (Q8EF78) Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)| Length = 727 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 184 HLQLIRTKGS*VVCCQPCQWGDVSWVGSASWLVLHLTGTTVQRQTH 321 H +++ TKG V G ++++ S WL+L LTG + Q H Sbjct: 387 HSRILPTKGLHWVSRLHLMTGIMAYLSSPFWLLLILTGLMLALQAH 432 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,455,038 Number of Sequences: 219361 Number of extensions: 1135147 Number of successful extensions: 2520 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2519 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)