Clone Name | rbastl03g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DPP10_RAT (Q6Q629) Inactive dipeptidyl peptidase 10 (Dipeptidyl ... | 31 | 1.6 | 2 | GUX1_NEUCR (P38676) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoc... | 31 | 1.6 |
---|
>DPP10_RAT (Q6Q629) Inactive dipeptidyl peptidase 10 (Dipeptidyl peptidase X)| (Kv4 potassium channel auxiliary subunit) Length = 796 Score = 30.8 bits (68), Expect = 1.6 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 36 DHHFFHCNTVINTATNQETDAAA-SLEYLGRDMEREGVYRSSNV 164 D FF C TV+ ++ + A+A S YLG + E Y++S+V Sbjct: 664 DEKFFKCGTVVAPISDMKLYASAFSERYLGMPSKEESTYQASSV 707
>GUX1_NEUCR (P38676) Exoglucanase 1 precursor (EC 3.2.1.91)| (Exocellobiohydrolase 1) (1,4-beta-cellobiohydrolase) Length = 516 Score = 30.8 bits (68), Expect = 1.6 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = -3 Query: 350 SSTPVHTPYISASQKPKTQELSSSTKLQHPS--YALHARSDDGMSMSESFACMHAYACAR 177 S TP P SAS T + SS++ +PS A H G+ S C Y CA+ Sbjct: 448 SGTPPSNPSSSASPTSSTAKPSSTSTASNPSGTGAAHWAQCGGIGFSGPTTCPEPYTCAK 507 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,928,089 Number of Sequences: 219361 Number of extensions: 1013630 Number of successful extensions: 3113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3110 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)