Clone Name | rbastl03g03 |
---|---|
Clone Library Name | barley_pub |
>S6A19_PONPY (Q5R6J1) Sodium-dependent neutral amino acid transporter B(0)| (System B(0) neutral amino acid transporter) (B(0)AT1) (Solute carrier family 6 member 19) Length = 634 Score = 29.3 bits (64), Expect = 4.9 Identities = 12/52 (23%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = -1 Query: 454 FVWY------NAYIGSFPKLRWLFIICVAAVWTSLTIVDIKQLSTENHVVWL 317 + WY + I ++W ++C+A W+ L + I+ + T VV++ Sbjct: 174 YFWYRETLNISTSISDSGSIQWRMLLCLACAWSVLYMCTIRGIETTGKVVYI 225
>CCG1_MOUSE (O70578) Voltage-dependent calcium channel gamma-1 subunit| (Dihydropyridine-sensitive L-type, skeletal muscle calcium channel gamma subunit) Length = 223 Score = 29.3 bits (64), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 239 IKHYINWSAACKLTSIHLVSKGILLLVRFSI 147 I+HY +WS AC + L+ G L L+ FS+ Sbjct: 175 IEHYYSWSFACACAAFILLFLGGLFLLLFSL 205
>ADA2B_CAVPO (Q60475) Alpha-2B adrenergic receptor (Alpha-2B adrenoceptor)| (Alpha-2B adrenoreceptor) Length = 448 Score = 28.9 bits (63), Expect = 6.4 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 14/66 (21%) Frame = +1 Query: 157 LTSRRIPFDTKWMLVNLQAADQLM*CLIL--------------WKIFCR*LFYVSTMVQG 294 LTSR +P LV+L AAD L+ LI+ W+ +C Y++ V Sbjct: 38 LTSRSLPAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFWRTWCE--VYLALDVLF 95 Query: 295 CTCSLV 312 CT S+V Sbjct: 96 CTSSIV 101
>NHR77_CAEEL (O02316) Nuclear hormone receptor family member nhr-77| Length = 362 Score = 28.5 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 103 CGFLQYPENVIFHLRGLLIKYCASFF 26 C ++P NV H GL+ CA+FF Sbjct: 11 CPVCEFPSNVELHFGGLVCGACAAFF 36
>NH174_CAEEL (O17748) Nuclear hormone receptor family member nhr-174| Length = 382 Score = 28.5 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 103 CGFLQYPENVIFHLRGLLIKYCASFF 26 C ++P NV H GL+ CA+FF Sbjct: 65 CPVCEFPSNVELHFGGLVCGACAAFF 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,203,248 Number of Sequences: 219361 Number of extensions: 1390442 Number of successful extensions: 2485 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2485 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)