Clone Name | rbastl03f06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HAP1_HAEIN (P44596) Adhesion and penetration protein precursor (... | 33 | 0.12 | 2 | STE3_YEAST (P06783) Pheromone a factor receptor | 30 | 1.1 | 3 | UXAC_BACLD (Q65F21) Uronate isomerase (EC 5.3.1.12) (Glucuronate... | 28 | 6.8 | 4 | Y539_AQUAE (O66818) Hypothetical protein aq_539 | 28 | 6.8 | 5 | YFC5_YEAST (P43571) Hypothetical 117.8 kDa protein in STE2-FRS2 ... | 27 | 8.9 |
---|
>HAP1_HAEIN (P44596) Adhesion and penetration protein precursor (EC 3.4.21.-)| Length = 1409 Score = 33.5 bits (75), Expect = 0.12 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = +3 Query: 168 GVQPSCLSTDC-RGEKAAMELCLTIVLRSTR*TNYFP*KWAQ-KINNRNRATVKVINALA 341 GV P+ +T C R + + C T+ L T+ N P IN N ATV + Sbjct: 705 GVVPNXQNTICTRSDWTGLTTCKTVNLTDTKVINSIPITQINGSINLTNNATVNIHGLAK 764 Query: 342 TRTHVTAPDHSSSSMKQNS 398 +VT DHS ++ N+ Sbjct: 765 LNGNVTLIDHSQFTLSNNA 783
>STE3_YEAST (P06783) Pheromone a factor receptor| Length = 470 Score = 30.4 bits (67), Expect = 1.1 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 107 RIFNYCLSRFSSALNLLTAAWRTTVLF 187 ++F Y ++R++ NLL+ W TTVL+ Sbjct: 135 QVFRYGIARYNGCQNLLSPTWITTVLY 161
>UXAC_BACLD (Q65F21) Uronate isomerase (EC 5.3.1.12) (Glucuronate isomerase)| (Uronic isomerase) Length = 473 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 338 ESIDHLDCSPVTVVYFLRPFLGEIISSAC 252 +S+D D P T++Y L P +ISS C Sbjct: 333 DSLDRKDALPKTILYSLNPRDNVVISSLC 361
>Y539_AQUAE (O66818) Hypothetical protein aq_539| Length = 285 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 80 FISFRIASYRIFNYCLSRFSSALNLLTAAWRTTVLFE 190 F SFRI+ +RIF YC F + L++A T+L E Sbjct: 85 FYSFRISDFRIFLYCSIPFLTFF-LISALLSNTLLEE 120
>YFC5_YEAST (P43571) Hypothetical 117.8 kDa protein in STE2-FRS2 intergenic| region Length = 1029 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 37 IRSTKGTDQPSCENIYIFP 93 ++ G D P CE+IY+FP Sbjct: 74 LKPFNGADAPQCESIYMFP 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,056,723 Number of Sequences: 219361 Number of extensions: 920218 Number of successful extensions: 1709 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1707 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)