| Clone Name | rbastl03f03 |
|---|---|
| Clone Library Name | barley_pub |
>A2MG_MOUSE (Q61838) Alpha-2-macroglobulin precursor (Alpha-2-M) [Contains:| Alpha-2-macroglobulin 165 kDa subunit; Alpha-2-macroglobulin 35 kDa subunit] Length = 1495 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -1 Query: 332 VFVEISPSFLSVGEGGFKG*MVCWGSTLKSLSWTI 228 V +EISP FL+V GG + G+ K++SW + Sbjct: 838 VDLEISPDFLAVPVGGHENSHCICGNERKTVSWAV 872
>SMRC1_MOUSE (P97496) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily C member 1 (SWI/SNF complex 155 kDa subunit) (BRG1-associated factor 155) (SWI3-related protein) Length = 1104 Score = 29.3 bits (64), Expect = 4.5 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 6/81 (7%) Frame = +1 Query: 193 TKIPKTWLNKSQI-VHDNDFKVEPQQTIY-----PLNPPSPTDKKLGDISTKTKPCQDPH 354 T + W+N+ V +N V +Q I P+ P D+K S K KP P Sbjct: 272 TDVFNEWMNEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASANSRKRKPSPSPP 331 Query: 355 PPYHMFSTARTITEGQQRWLG 417 PP S ++ +GQ G Sbjct: 332 PPTATESRKKSGKKGQASLYG 352
>TIM50_CRYNE (Q5KNV7) Import inner membrane translocase subunit TIM50,| mitochondrial precursor Length = 516 Score = 28.9 bits (63), Expect = 5.9 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +2 Query: 257 NPSRPFIP*TRLPPQTRNLVIFQQKQSPVRTPTPLTICSPQP 382 NPS+PF P T QQ + P TPLT PQP Sbjct: 51 NPSQPFEPEVSKSEGTAKAAETQQAEEPASAGTPLT--PPQP 90
>YMD7_YEAST (Q03703) Hypothetical 38.0 kDa protein in CAT2-AMD1 intergenic| region Length = 340 Score = 28.5 bits (62), Expect = 7.7 Identities = 18/50 (36%), Positives = 21/50 (42%) Frame = +1 Query: 187 ATTKIPKTWLNKSQIVHDNDFKVEPQQTIYPLNPPSPTDKKLGDISTKTK 336 A K P TW N +DFKV+P Q P K GD + K K Sbjct: 169 ADGKKPSTWAN-------SDFKVDPLQKFVVKELPKEKKKSDGDKTKKNK 211
>FATH_HUMAN (Q14517) Cadherin-related tumor suppressor homolog precursor (Protein| fat homolog) Length = 4590 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 274 YPLNPPSPTDKKLGDISTKTKPCQDPHPPY 363 YPL+ P K G+ ST C++PH PY Sbjct: 4496 YPLDMSEPQTKGTGENST----CREPHAPY 4521
>KR1_BHV1S (Q08097) Serine/threonine-protein kinase (EC 2.7.11.1)| Length = 467 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 286 PPSPTDKKLGDISTKTKPCQDPHPPYHMFSTAR 384 PPSPTD+ + ++PH PY + R Sbjct: 398 PPSPTDRLTRNFKRHAATGREPHSPYRCLAVLR 430 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,354,142 Number of Sequences: 219361 Number of extensions: 1179194 Number of successful extensions: 3252 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3246 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)