Clone Name | rbastl03e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CLH_CAEEL (P34574) Probable clathrin heavy chain protein 1 | 30 | 3.7 | 2 | WNK1_HUMAN (Q9H4A3) Serine/threonine-protein kinase WNK1 (EC 2.7... | 28 | 8.2 | 3 | CR2_MOUSE (P19070) Complement receptor type 2 precursor (Cr2) (C... | 28 | 8.2 | 4 | DPOL_ADEG1 (Q64751) DNA polymerase (EC 2.7.7.7) | 28 | 8.2 |
---|
>CLH_CAEEL (P34574) Probable clathrin heavy chain protein 1| Length = 1681 Score = 29.6 bits (65), Expect = 3.7 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 446 LGIHRGTQLLPMGEDMNELVRLHTTKSQVPDMVMEESNRADLQG 315 +GI+R Q+L + D LV T + Q PD+ ++ + R DL G Sbjct: 314 MGINRKGQVLSVSIDEANLVPFVTNQLQNPDLALKLAVRCDLPG 357
>WNK1_HUMAN (Q9H4A3) Serine/threonine-protein kinase WNK1 (EC 2.7.11.1)| (Protein kinase with no lysine 1) (Protein kinase, lysine-deficient 1) (Kinase deficient protein) Length = 2382 Score = 28.5 bits (62), Expect = 8.2 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 239 HFTAHFKPIGQPQDKLPTYLLELYSV 316 H AHF P+GQP LPT LL Y V Sbjct: 819 HSGAHFLPVGQP---LPTPLLPQYPV 841
>CR2_MOUSE (P19070) Complement receptor type 2 precursor (Cr2) (Complement C3d| receptor) (CD21 antigen) Length = 1025 Score = 28.5 bits (62), Expect = 8.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 114 YFGKLSCDPSPESEKYRGSFATVYVVHT*IDRVEC 10 YF ++SCDP PE + R + ++ +V + R C Sbjct: 8 YFSEISCDPPPEVKNARKPYYSLPIVPGTVLRYTC 42
>DPOL_ADEG1 (Q64751) DNA polymerase (EC 2.7.7.7)| Length = 1121 Score = 28.5 bits (62), Expect = 8.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 324 ICPVAFLHNHVWHLGLCRV*ADQLVHVFPHWQQLCA 431 + + LHN W + +V D++ VFP W+ LCA Sbjct: 602 VIDILTLHNRGWRV---QVLHDEMNIVFPEWKTLCA 634 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,697,390 Number of Sequences: 219361 Number of extensions: 1290161 Number of successful extensions: 3275 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3275 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)