Clone Name | rbastl03e07 |
---|---|
Clone Library Name | barley_pub |
>CFA_ECOLI (P0A9H7) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 35.8 bits (81), Expect = 0.047 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = -3 Query: 411 LALGFDERFLRIWEYYLIFSAAGFKSRAIGDYQVVFSR 298 +A + ERF R++ YYL A F++R I +QVVFSR Sbjct: 334 IADNYSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>CFA_ECOL6 (P0A9H8) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 35.8 bits (81), Expect = 0.047 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = -3 Query: 411 LALGFDERFLRIWEYYLIFSAAGFKSRAIGDYQVVFSR 298 +A + ERF R++ YYL A F++R I +QVVFSR Sbjct: 334 IADNYSERFKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>CFA_CITFR (P45509) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) (Fragment) Length = 89 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -3 Query: 411 LALGFDERFLRIWEYYLIFSAAGFKSRAIGDYQVVFSR 298 L+ + F R++ YYL A F++R I +QV+FSR Sbjct: 42 LSSRYSATFRRMFNYYLCACAGAFRARDIELWQVLFSR 79
>SYA_PROMP (Q7V3N0) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 886 Score = 28.5 bits (62), Expect = 7.6 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 145 NHLSRIRA*ANHSRTDLLKSRTVLTSNDSAAER 243 N L+R +A ANH+ T LL+S + N+S ++ Sbjct: 553 NDLARAKAAANHTATHLLQSALKVVVNESVGQK 585
>PRPC2_CORGL (Q8NSL1) 2-methylcitrate synthase 2 (EC 2.3.3.5) (Methylcitrate| synthase 2) (Citrate synthase 2) Length = 383 Score = 28.1 bits (61), Expect = 9.9 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 116 AWLNNKIDHQTT*VGFGH 169 AW+NN +D++ +GFGH Sbjct: 252 AWINNALDNKNVVMGFGH 269 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,141,428 Number of Sequences: 219361 Number of extensions: 1363844 Number of successful extensions: 2568 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2568 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)