Clone Name | rbastl03d09 |
---|---|
Clone Library Name | barley_pub |
>GIL1_ENTHI (P32022) Galactose-inhibitable lectin 170 kDa subunit| Length = 1276 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = -1 Query: 388 DPSPSFTSYCWSFCCYSRDQYAKVEELVPERC---RNDFPKFRKHTEQKGTTEDNI 230 D PS YCWS+ C + K ++ E C N+ ++ +EQ+ + D + Sbjct: 485 DQKPSSDGYCWSYTCDQTTGFCKKDKRGKEMCTGKTNNCQEYVCDSEQRCSVRDKV 540
>CYAA_SACKL (P23466) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 1839 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 337 RDQYAKVEELVPERCRNDFPKFRKHTEQKGTTEDNIEKE 221 R+++ ++EE E N PKF+KH TT N E + Sbjct: 14 REKHPQIEETFEEHVHNAMPKFKKHYALGITTHTNDEDD 52
>PYRB_BACTN (Q8A9S3) Aspartate carbamoyltransferase (EC 2.1.3.2) (Aspartate| transcarbamylase) (ATCase) Length = 313 Score = 30.4 bits (67), Expect = 2.6 Identities = 18/69 (26%), Positives = 36/69 (52%) Frame = -1 Query: 295 CRNDFPKFRKHTEQKGTTEDNIEKESLKHMILIRRGKLNLQVEYVSIRK*LLLPNVILQM 116 C+ K+ +HTE TE+ I + +M ++R + +EY ++ +L N +L+ Sbjct: 196 CKEHQIKYIEHTE---FTEEIIADADILYMTRVQRERFTDLMEYERVKNVYILRNKMLEN 252 Query: 115 TKLTVNILY 89 T+ + IL+ Sbjct: 253 TRPNLRILH 261
>YCF2_MARPO (P09975) Protein ycf2| Length = 2136 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/42 (30%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 159 LTYSTCKFNFPRLIRIICFRLSFSILSSV-VPFCSVCFLNLG 281 LTY+ K NF R+ +I+ +++ +I+ ++ + S+ LN+G Sbjct: 1623 LTYTNNKLNFDRIFKIVIYKVGKTIIQNILIKSSSMNLLNIG 1664
>ULA1_SCHPO (Q9UT93) NEDD8-activating enzyme E1 regulatory subunit| (Ubiquitin-like activation protein 1) (Ubiquitin-activating enzyme E1-like 1) Length = 500 Score = 29.6 bits (65), Expect = 4.4 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = -1 Query: 340 SRDQYAKVEELVPERCRNDFPKFRKHTEQK----GTTEDNIEKESLKHMILIRRGKLNLQ 173 S QY K++ + E+ ND KF+K+ +Q + + I +KH R LN++ Sbjct: 322 STQQYVKLQVIYKEKSENDILKFKKYVQQTLKRLNRSVEEITDLEIKH---FSRNCLNIK 378 Query: 172 V 170 V Sbjct: 379 V 379
>PUB2_SCHPO (Q9UTG2) E3 ubiquitin--protein ligase pub2 (EC 6.3.2.-)| Length = 671 Score = 29.6 bits (65), Expect = 4.4 Identities = 11/42 (26%), Positives = 26/42 (61%) Frame = -1 Query: 328 YAKVEELVPERCRNDFPKFRKHTEQKGTTEDNIEKESLKHMI 203 + K+E L P++ + F +F + + K + + N+E + +KH++ Sbjct: 183 HEKLENLTPKQLKEVFSQFLFNNQSKSSLKINLEYKVIKHLL 224
>VATE_PYRFU (Q8U4A9) V-type ATP synthase subunit E (EC 3.6.3.14) (V-type ATPase| subunit E) Length = 198 Score = 29.3 bits (64), Expect = 5.7 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = -1 Query: 343 YSRDQYAKVEELVPERCRNDFPKFRKHTEQKGTTEDNIEKESL--KHMILIRRGKLNLQV 170 Y D+ K E + E R + +K T+ +EK+ + + +RR KL+LQ Sbjct: 21 YILDEARKEAEKIKEEARKRGESRAEWILRKAKTQAELEKQRIIATARLEVRRKKLSLQE 80 Query: 169 EYVS 158 EY+S Sbjct: 81 EYIS 84
>YIF1A_BRARE (Q6PC24) Protein YIF1A (YIP1-interacting factor homolog A)| Length = 307 Score = 28.5 bits (62), Expect = 9.7 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 114 VICKITLGSNSYFLILTYSTCKFNFPRLIRIICFRLSFSILSSV 245 V C + GS+ Y++ L +S+C F I L ILSS+ Sbjct: 229 VFCGLLFGSDGYYVALAWSSCALMF-----FIVRSLKMKILSSI 267
>PDCD1_HUMAN (Q15116) Programmed cell death protein 1 precursor (Protein PD-1)| (hPD-1) (CD279 antigen) Length = 288 Score = 28.5 bits (62), Expect = 9.7 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +1 Query: 25 TCSMNNATK-FVLNWYKILVNNGT 93 TCS +N ++ FVLNWY++ +N T Sbjct: 53 TCSFSNTSESFVLNWYRMSPSNQT 76
>HYPF_SYNY3 (Q55638) Carbamoyltransferase hypF (EC 2.1.3.-) (Carbamoyl| phosphate-converting enzyme hypF) ([NiFe]-hydrogenase maturation factor hypF) (Hydrogenase maturation protein hypF) Length = 767 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 388 DPSPSFTSYCWSFCCYSRDQYAKVEELVPERCRNDFPKFRKHTE 257 DPS Y + C + +Y +E L +RCR +FR+ T+ Sbjct: 116 DPSDRRYLYPFINCTHCGPRYTIIEALPYDRCRTTMARFRQCTD 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,479,093 Number of Sequences: 219361 Number of extensions: 1147290 Number of successful extensions: 2745 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2745 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)