Clone Name | rbastl03c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PER_PERAM (Q25637) Period circadian protein | 31 | 0.91 | 2 | ARGD_RHILO (Q98BB7) Acetylornithine aminotransferase (EC 2.6.1.1... | 28 | 5.9 | 3 | MS57C_DROME (Q9V3J3) Accessory gland-specific peptide 57Dc precu... | 28 | 5.9 | 4 | YO078_YEAST (Q08236) Protein YOL078W | 28 | 7.7 |
---|
>PER_PERAM (Q25637) Period circadian protein| Length = 893 Score = 30.8 bits (68), Expect = 0.91 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 157 NEPMPQVKSVKRNKTKPY*LQMLLTSVNRGYVQTPTQIAPT 279 NEP PQ KRNK K + + L +SV T T + T Sbjct: 56 NEPFPQPSVTKRNKDKEHKKKKLKSSVTTAATATVTSVVTT 96
>ARGD_RHILO (Q98BB7) Acetylornithine aminotransferase (EC 2.6.1.11) (ACOAT)| Length = 399 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 221 ICS*YGLVLFRFTDLTCGIGSFWRCRAHHWYG 126 +C +GL+L + ++ CGIG + AH W G Sbjct: 204 LCDQHGLLLI-YDEVQCGIGRTGKLFAHEWSG 234
>MS57C_DROME (Q9V3J3) Accessory gland-specific peptide 57Dc precursor (Male| accessory gland secretory protein 57Dc) (45-kDa cAMP-dependent phosphoprotein) (Pp45) Length = 103 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 59 HSNLPVILCNQIGSTAASPGINGHTSDERGTAKMNRCRKSS 181 H + ++LC +GS +P I ER M RC K + Sbjct: 32 HFLILLLLCGVLGSNGVTPDIKNVAKAERNMHNMLRCLKKN 72
>YO078_YEAST (Q08236) Protein YOL078W| Length = 1176 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 Query: 119 INGHTSDERGTAKMNRCRKSSR*NETKPN 205 + GH S GTA MNR K SR N + N Sbjct: 409 LGGHESTNDGTAVMNRDSKDSRSNSNEFN 437 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,991,961 Number of Sequences: 219361 Number of extensions: 835487 Number of successful extensions: 1819 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1819 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)