ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl03c06 |
|---|---|
| Clone Library Name | barley_pub |
>APE2_YEAST (P32454) Aminopeptidase 2 (EC 3.4.11.-) (Aminopeptidase II) (AP-II)| (YscII) Length = 844 Score = 51.2 bits (121), Expect = 1e-06 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = -3 Query: 437 NWDHVVKTWPSS-SLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSLERVR 261 NWD +VK P S++ V S FTS +K E+ +FFAT+ F+++L QSL+ + Sbjct: 779 NWDELVKRLPPGLSMLGSVVTLGTSGFTSMQKIDEIKKFFATKSTKGFDQSLAQSLDTIT 838 Query: 260 ISARW 246 A+W Sbjct: 839 SKAQW 843
>PSA_HUMAN (P55786) Puromycin-sensitive aminopeptidase (EC 3.4.11.-) (PSA)| Length = 919 Score = 50.4 bits (119), Expect = 2e-06 Identities = 26/85 (30%), Positives = 43/85 (50%) Frame = -3 Query: 440 DNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSLERVR 261 DNW+ + + LIS + +V F ++ A EV FF + PS ER ++Q E + Sbjct: 833 DNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENIL 892 Query: 260 ISARWIDSIKSEPSLAQTVQQLLLQ 186 ++A W+ A+++ Q LLQ Sbjct: 893 LNAAWLKRD------AESIHQYLLQ 911
>PSA_MOUSE (Q11011) Puromycin-sensitive aminopeptidase (EC 3.4.11.-) (PSA)| Length = 920 Score = 48.9 bits (115), Expect = 6e-06 Identities = 26/85 (30%), Positives = 42/85 (49%) Frame = -3 Query: 440 DNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSLERVR 261 DNW+ + + LIS + +V F ++ A EV FF + PS ER ++Q E + Sbjct: 834 DNWEELHNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENIL 893 Query: 260 ISARWIDSIKSEPSLAQTVQQLLLQ 186 ++A W+ A ++ Q LLQ Sbjct: 894 LNAAWLKRD------ADSIHQYLLQ 912
>AAP1_YEAST (P37898) Alanine/arginine aminopeptidase (EC 3.4.11.-)| Length = 856 Score = 44.3 bits (103), Expect = 1e-04 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = -3 Query: 440 DNWDHVVKTW-PSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSFERALKQSLERV 264 ++WD + K P S ++ + ++ FTS E ++S F++ +V F++ L Q+L+ + Sbjct: 772 EHWDEIAKRLQPGSPVLGGVLTLGLTNFTSFEALEKISAFYSRKVTKGFDQTLAQALDTI 831 Query: 263 RISARWI 243 R A+W+ Sbjct: 832 RSKAQWV 838
>APE1_SCHPO (Q9USX1) Aminopeptidase 1 (EC 3.4.11.-) (Aminopeptidase I)| Length = 882 Score = 39.3 bits (90), Expect = 0.004 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = -3 Query: 437 NWDHVVKTWPSSSLISDFVNSTV-SPFTSEEKAAEVSQFFATRVKPSFERALKQSLERVR 261 NWD ++ P + + +V V S FT ++ +FFA + +ERAL+QSL+ + Sbjct: 800 NWDKLLSRLPVAGTMRGYVVRFVTSGFTHASAIDKIKEFFADKDTKLYERALQQSLDTIS 859 Query: 260 ISARWID 240 ++ +ID Sbjct: 860 ANSSFID 866
>SYI_CHLAB (Q5L5L0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1043 Score = 34.3 bits (77), Expect = 0.14 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = -3 Query: 338 EVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPSLAQT-VQQLLLQEF*AAPLY 162 E F T VKP+F +SL R R+ + D K+ SL+Q +QQLL QE+ + L Sbjct: 862 EAPSFVKTTVKPNF-----RSLGR-RVGEKIKDIQKALASLSQAQIQQLLTQEYLSLNLG 915 Query: 161 EEEIMCH 141 EEI+ H Sbjct: 916 SEEIVLH 922
>AMPN_PIG (P15145) Aminopeptidase N (EC 3.4.11.2) (pAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (gp130) (CD13 antigen) Length = 962 Score = 33.1 bits (74), Expect = 0.31 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 11/79 (13%) Frame = -3 Query: 434 WDHVVKTWPS--------SSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERA 288 WD V W S S+ + F+SE + ++ QF + F RA Sbjct: 873 WDFVQSNWKKLFQDYGGGSFSFSNLIQGVTRRFSSEFELQQLEQFKKNNMDVGFGSGTRA 932 Query: 287 LKQSLERVRISARWIDSIK 231 L+Q+LE+ + + +W+ K Sbjct: 933 LEQALEKTKANIKWVKENK 951
>AMPN_RABIT (P15541) Aminopeptidase N (EC 3.4.11.2) (rbAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (CD13 antigen) Length = 965 Score = 33.1 bits (74), Expect = 0.31 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 11/79 (13%) Frame = -3 Query: 434 WDHVVKTWPS--------SSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERA 288 WD V W S ++ + + F++E + ++ QF + F RA Sbjct: 875 WDFVQSNWKKLFEDFGGGSFSFANLIRAVTRRFSTEYELQQLEQFRLNNLDTGFGSGTRA 934 Query: 287 LKQSLERVRISARWIDSIK 231 L+Q+LE+ R + +W+ K Sbjct: 935 LEQALEQTRANIKWVQENK 953
>AMPN_FELCA (P79171) Aminopeptidase N (EC 3.4.11.2) (fAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (CD13 antigen) Length = 966 Score = 32.7 bits (73), Expect = 0.41 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 11/79 (13%) Frame = -3 Query: 434 WDHVVKTWPS--------SSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERA 288 WD V W S S+ + + F++E + ++ QF + F RA Sbjct: 877 WDFVQSNWKKLFQDYGTGSFSFSNLIQAVTRRFSTEFELQQLEQFKKNNMDTGFGSATRA 936 Query: 287 LKQSLERVRISARWIDSIK 231 L+Q+LE+ + + +W+ K Sbjct: 937 LEQALEKTKANLKWVKENK 955
>AMPN_HUMAN (P15144) Aminopeptidase N (EC 3.4.11.2) (hAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (gp150) (Myeloid plasma membrane glycoprotein CD13) (CD13 antigen) Length = 966 Score = 32.3 bits (72), Expect = 0.54 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 11/79 (13%) Frame = -3 Query: 434 WDHVVKTWPS--------SSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERA 288 WD V W S S+ + + F++E + ++ QF + F RA Sbjct: 876 WDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRA 935 Query: 287 LKQSLERVRISARWIDSIK 231 L+Q+LE+ + + +W+ K Sbjct: 936 LEQALEKTKANIKWVKENK 954
>AMPN_MOUSE (P97449) Aminopeptidase N (EC 3.4.11.2) (mAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (Membrane protein p161) (CD13 antigen) Length = 965 Score = 32.0 bits (71), Expect = 0.70 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 11/79 (13%) Frame = -3 Query: 434 WDHVVKTWPS--------SSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERA 288 WD V W S ++ + F+SE + ++ QF A F RA Sbjct: 875 WDFVRSNWKKLFENYGGGSFSFANLIQGVTRRFSSEFELQQLEQFKADNSATGFGTGTRA 934 Query: 287 LKQSLERVRISARWIDSIK 231 L+Q+LE+ R + W+ K Sbjct: 935 LEQALEKTRANIDWVKENK 953
>AMPN_LACHE (Q10730) Aminopeptidase N (EC 3.4.11.2) (Lysyl aminopeptidase)| (Lys-AP) (Alanine aminopeptidase) Length = 844 Score = 30.8 bits (68), Expect = 1.6 Identities = 16/71 (22%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = -3 Query: 440 DNWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVK-PSFERALKQSLERV 264 ++WD + KT + F+ T F + E+ E +FF ++ P R +K ++ + Sbjct: 762 EDWDWLDKTVGGDMEFAKFITVTAGVFHTPERLKEFKEFFEPKINVPLLSREIKMDVKVI 821 Query: 263 RISARWIDSIK 231 I++ K Sbjct: 822 ESKVNLIEAEK 832
>AMPN_RAT (P15684) Aminopeptidase N (EC 3.4.11.2) (rAPN) (Alanyl| aminopeptidase) (Microsomal aminopeptidase) (Aminopeptidase M) (APM) (Kidney Zn peptidase) (KZP) (CD13 antigen) Length = 964 Score = 30.4 bits (67), Expect = 2.0 Identities = 19/79 (24%), Positives = 33/79 (41%), Gaps = 11/79 (13%) Frame = -3 Query: 434 WDHVVKTWPS--------SSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKPSF---ERA 288 WD V W S ++ + F+SE + ++ QF F RA Sbjct: 875 WDFVRSNWKKLFEDYGGGSFSFANLIQGVTRRFSSEFELQQLEQFKEDNSATGFGSGTRA 934 Query: 287 LKQSLERVRISARWIDSIK 231 L+Q+LE+ + + +W+ K Sbjct: 935 LEQALEKTKANIKWVKENK 953
>RS6_RAT (P62755) 40S ribosomal protein S6| Length = 249 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -3 Query: 356 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 219 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_MOUSE (P62754) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -3 Query: 356 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 219 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>RS6_HUMAN (P62753) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = -3 Query: 356 SEEKAAEVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPS 219 ++E+AAE ++ A R+K + E+ +Q +R R+S+ + KSE S Sbjct: 202 NKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESS 247
>AMPE_HUMAN (Q07075) Glutamyl aminopeptidase (EC 3.4.11.7) (EAP) (Aminopeptidase| A) (APA) (Differentiation antigen gp160) (CD249 antigen) Length = 957 Score = 29.3 bits (64), Expect = 4.5 Identities = 16/66 (24%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = -3 Query: 437 NWDHVVKTWPSSSLISDFVNSTVSPFTSEEKAAEVSQFFATRVKP-SFERALKQSLERVR 261 NWD++V + ++ + + PF +E + ++ FFA + + E+ +Q LE V+ Sbjct: 874 NWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVK 933 Query: 260 ISARWI 243 + W+ Sbjct: 934 NNIEWL 939 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,620,445 Number of Sequences: 219361 Number of extensions: 871984 Number of successful extensions: 2455 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2455 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
