Clone Name | rbastl03c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TA2R8_PONPY (Q645U8) Taste receptor type 2 member 8 (T2R8) | 30 | 2.2 | 2 | ALMS1_MOUSE (Q8K4E0) Alstrom syndrome protein 1 homolog | 28 | 8.4 | 3 | TILS_NITEU (Q82VP4) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tR... | 28 | 8.4 |
---|
>TA2R8_PONPY (Q645U8) Taste receptor type 2 member 8 (T2R8)| Length = 309 Score = 30.4 bits (67), Expect = 2.2 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 120 MYQIKQSLVRITNNTKKKKLDVTINHAGSYLQPEGHPFSVRLLANKLRR 266 +Y I LV + K KL + + L P GH F + +L NKLR+ Sbjct: 246 LYYITSLLVTFSYLMTKYKLAMAFGEIVAILYPSGHSFILIILNNKLRQ 294
>ALMS1_MOUSE (Q8K4E0) Alstrom syndrome protein 1 homolog| Length = 3251 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 75 LNEQIA-SAMYDSSQIMYQIKQSLVRITNNTKKKKLDVTINHAGSYLQPEGHPFS 236 L+ Q+A S++ DS I +K + + ++ V I+H Y +PEG P S Sbjct: 2256 LDLQVAQSSLPDSKTIFQDLKTKPPQNSQIVTSRQTQVNISHLEGYSKPEGTPVS 2310
>TILS_NITEU (Q82VP4) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 458 Score = 28.5 bits (62), Expect = 8.4 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 117 IMYQIKQSLVRITNNTKKKKLDVTINHAGSYLQPEGH-PFSVRLLANKLRRGLQE 278 + Y + Q L+R+ N+TK +++ +N+ +QP+ H F V L + RGL E Sbjct: 273 LRYLLAQRLIRLPNSTKLEEILRQLNN----IQPDNHFRFIVDTLEIRCHRGLIE 323 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,751,012 Number of Sequences: 219361 Number of extensions: 1281742 Number of successful extensions: 2728 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2728 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)