Clone Name | rbastl03b11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | 104K_THEPA (P15711) 104 kDa microneme-rhoptry antigen precursor ... | 32 | 0.91 | 2 | HEMK_RICCN (Q92G13) Bifunctional methyltransferase [Includes: He... | 28 | 7.7 | 3 | HEMK_RICFE (Q4UJU4) Bifunctional methyltransferase [Includes: He... | 28 | 7.7 |
---|
>104K_THEPA (P15711) 104 kDa microneme-rhoptry antigen precursor (p104)| Length = 924 Score = 31.6 bits (70), Expect = 0.91 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = +3 Query: 126 PGPGEQH-----PSLCKLC*GPETPSHPSDKWDNKKRRGCKTTT 242 PGP +H P+L K GP+ P HP D + +K + +T + Sbjct: 553 PGPAREHKPSKIPTLSKKPSGPKDPKHPRDPKEPRKSKSPRTAS 596
>HEMK_RICCN (Q92G13) Bifunctional methyltransferase [Includes: HemK protein| homolog (EC 2.1.1.-) (M.RcoHemKP); tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA(m7G46)-methyltransferase)] Length = 524 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 271 NPNSLSMAPLLYLPSAFNALPCYSHQNISRWLIFVAN 381 NPN+L + +YL N L QNI+ +L+F N Sbjct: 369 NPNALFIGIEVYLNGVANVLKLAGEQNITNFLLFPNN 405
>HEMK_RICFE (Q4UJU4) Bifunctional methyltransferase [Includes: HemK protein| homolog (EC 2.1.1.-); tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA(m7G46)-methyltransferase)] Length = 527 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 271 NPNSLSMAPLLYLPSAFNALPCYSHQNISRWLIFVAN 381 NP++L + +YL N L S QNI+ +L+F N Sbjct: 372 NPDALFIGVEVYLNGVANVLKLASEQNITNFLLFPNN 408 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,097,867 Number of Sequences: 219361 Number of extensions: 1285873 Number of successful extensions: 3351 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3351 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)