Clone Name | rbastl03b07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VG27_BPMD2 (O64221) Minor tail protein Gp27 | 29 | 4.5 | 2 | TM7S4_HUMAN (Q9H295) Transmembrane 7 superfamily member 4 (Dendr... | 29 | 5.9 | 3 | LRRN5_HUMAN (O75325) Leucine-rich repeats neuronal protein 5 pre... | 29 | 5.9 | 4 | DND1_HUMAN (Q8IYX4) Dead end protein homolog 1 (RNA-binding moti... | 29 | 5.9 | 5 | CCG8_NEUCR (Q01306) Clock-controlled protein 8 | 28 | 7.7 |
---|
>VG27_BPMD2 (O64221) Minor tail protein Gp27| Length = 336 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 331 IPSTPWHLPPGTECSKHLPPLVQPAVGQWSF 423 IP PW PPG E P Q + +SF Sbjct: 216 IPDFPWPFPPGVEIPWETAPFTQFVIPDYSF 246
>TM7S4_HUMAN (Q9H295) Transmembrane 7 superfamily member 4 (Dendritic| cell-specific transmembrane protein) (DC-STAMP) (IL-4-induced protein) (FIND) Length = 470 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 6/49 (12%) Frame = -3 Query: 309 VDPASDGMACELE*LG-CCWVCLVNK-----SAAWRILVVLHAAASWFI 181 V P S G ++ LG CC V L++ +A W + ++ AAASW I Sbjct: 19 VSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIAAAASWII 67
>LRRN5_HUMAN (O75325) Leucine-rich repeats neuronal protein 5 precursor (Glioma| amplified on chromosome 1 protein) Length = 713 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 292 IAGWIYGL*KTILIPSTPWHLPPGTECSKHLPPLVQP 402 + W+ G T +P PWH+P +C+ + P P Sbjct: 9 LLAWVAGA--TAAVPVVPWHVPCPPQCACQIRPWYTP 43
>DND1_HUMAN (Q8IYX4) Dead end protein homolog 1 (RNA-binding motif,| single-stranded interacting protein 4) Length = 353 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 437 HGHPLKDHCPTAGCTSGGKCFEHSVPG 357 H HPL+ CP C S KC E SV G Sbjct: 119 HNHPLRPSCPLLVCRSTEKC-ELSVDG 144
>CCG8_NEUCR (Q01306) Clock-controlled protein 8| Length = 661 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 40 QTHTHTPHQRRIQS*RHAVHCTAMKHL*PHIHHRN 144 Q H H HQ+ Q +H H A +H H HH + Sbjct: 16 QQHEHQQHQQYQQPPQHHQHYEAPQHQQQHQHHHH 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,541,193 Number of Sequences: 219361 Number of extensions: 851140 Number of successful extensions: 2321 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2318 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)