Clone Name | rbastl03b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DMN_HUMAN (O15061) Desmuslin | 30 | 3.6 | 2 | ZYX_MOUSE (Q62523) Zyxin | 30 | 4.7 | 3 | G6PI_DECAR (Q47IJ3) Glucose-6-phosphate isomerase (EC 5.3.1.9) (... | 29 | 8.1 |
---|
>DMN_HUMAN (O15061) Desmuslin| Length = 1565 Score = 30.0 bits (66), Expect = 3.6 Identities = 14/22 (63%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = +3 Query: 60 ASLKGHDGSNAG-SLGGDARRG 122 ++L GH GS G S+GGDARRG Sbjct: 376 SNLSGHRGSQTGTSIGGDARRG 397
>ZYX_MOUSE (Q62523) Zyxin| Length = 564 Score = 29.6 bits (65), Expect = 4.7 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 205 PTVIWERIPAPSNTTAHGGSILMWNGRTPRRASPPREPALEP 80 P V +P PS A GG+ + +TP + PP +P +P Sbjct: 176 PPVATPFVPKPSTKPAPGGTAPLPPWKTPSSSQPPPQPQRKP 217
>G6PI_DECAR (Q47IJ3) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)| (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) Length = 526 Score = 28.9 bits (63), Expect = 8.1 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +2 Query: 104 RRRSARGASIPHQDGTAVSSCVRRSGDSFPNNRRVIL 214 RRR G SI H +G AV R+GD P R L Sbjct: 75 RRRMLDGESINHTEGRAVRHMSLRAGDQAPAEVRAAL 111 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,891,338 Number of Sequences: 219361 Number of extensions: 1559328 Number of successful extensions: 4153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4152 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)