Clone Name | rbastl03a12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IL22_MOUSE (Q9JJY9) Interleukin-22 precursor (IL-22) (IL-10-rela... | 30 | 4.4 | 2 | IL22B_MOUSE (Q9JJY8) Interleukin-22b precursor (IL-22b) (IL-10-r... | 29 | 5.7 | 3 | PLMN_CANFA (P80009) Plasminogen (EC 3.4.21.7) [Contains: Plasmin... | 29 | 7.5 | 4 | PLMN_PIG (P06867) Plasminogen precursor (EC 3.4.21.7) [Contains:... | 28 | 9.7 |
---|
>IL22_MOUSE (Q9JJY9) Interleukin-22 precursor (IL-22) (IL-10-related| T-cell-derived-inducible factor) (IL-TIF) (IL-TIF alpha) (Interleukin-22a) (IL-22a) Length = 179 Score = 29.6 bits (65), Expect = 4.4 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 177 SSSILLVVLWAVENSSYPVASWCKVE 254 +S +LL+ LWA E ++ PV + CK+E Sbjct: 18 ASCLLLIALWAQEANALPVNTRCKLE 43
>IL22B_MOUSE (Q9JJY8) Interleukin-22b precursor (IL-22b) (IL-10-related| T-cell-derived-inducible factor beta) (IL-TIFb) (IL-TIF beta) Length = 179 Score = 29.3 bits (64), Expect = 5.7 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 177 SSSILLVVLWAVENSSYPVASWCKVE 254 +S +LL+ LWA E ++ P+ + CK+E Sbjct: 18 ASCLLLIALWAQEANALPINTRCKLE 43
>PLMN_CANFA (P80009) Plasminogen (EC 3.4.21.7) [Contains: Plasmin heavy chain| A; Plasmin light chain B] (Fragment) Length = 333 Score = 28.9 bits (63), Expect = 7.5 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = +1 Query: 337 P*CLMENHNVFF*ACKMPQTQSMSFQNSDPDCTFPGLAPVVSPLRIVHG 483 P C N F C +PQ S SF DC P + P P R+V G Sbjct: 64 PWCYTMNQRKLFDYCDVPQCVSTSF-----DCGKPQVEPKKCPGRVVGG 107
>PLMN_PIG (P06867) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 790 Score = 28.5 bits (62), Expect = 9.7 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = +1 Query: 337 P*CLMENHNVFF*ACKMPQTQSMSFQNSDPDCTFPGLAPVVSPLRIVHG 483 P C N F C +PQ + SF DC P + P P R+V G Sbjct: 521 PWCYTTNPQKLFDYCDVPQCVTSSF-----DCGKPKVEPKKCPARVVGG 564 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,236,756 Number of Sequences: 219361 Number of extensions: 1688908 Number of successful extensions: 3640 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3639 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)