| Clone Name | rbastl02h02 |
|---|---|
| Clone Library Name | barley_pub |
>PDCD1_HUMAN (Q15116) Programmed cell death protein 1 precursor (Protein PD-1)| (hPD-1) (CD279 antigen) Length = 288 Score = 32.0 bits (71), Expect = 0.61 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +1 Query: 34 WIPEIKRQALKIIVQYSHHT-TCSMNNATK-FVLNWYKILVNNGT 162 W P AL ++ + + T TCS +N ++ FVLNWY++ +N T Sbjct: 32 WNPPTFFPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQT 76
>PYRB_BACTN (Q8A9S3) Aspartate carbamoyltransferase (EC 2.1.3.2) (Aspartate| transcarbamylase) (ATCase) Length = 313 Score = 30.4 bits (67), Expect = 1.8 Identities = 18/69 (26%), Positives = 36/69 (52%) Frame = -1 Query: 364 CRNDFPKFRKHTEQKGTTEDNIEKESLKHMILIRRGKLNLQVEYVSIRK*LLLPNVILQM 185 C+ K+ +HTE TE+ I + +M ++R + +EY ++ +L N +L+ Sbjct: 196 CKEHQIKYIEHTE---FTEEIIADADILYMTRVQRERFTDLMEYERVKNVYILRNKMLEN 252 Query: 184 TKLTVNILY 158 T+ + IL+ Sbjct: 253 TRPNLRILH 261
>YCF2_MARPO (P09975) Protein ycf2| Length = 2136 Score = 30.0 bits (66), Expect = 2.3 Identities = 13/42 (30%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 228 LTYSTCKFNFPRLIRIICFRLSFSILSSV-VPFCSVCFLNLG 350 LTY+ K NF R+ +I+ +++ +I+ ++ + S+ LN+G Sbjct: 1623 LTYTNNKLNFDRIFKIVIYKVGKTIIQNILIKSSSMNLLNIG 1664
>PUB2_SCHPO (Q9UTG2) E3 ubiquitin--protein ligase pub2 (EC 6.3.2.-)| Length = 671 Score = 29.6 bits (65), Expect = 3.0 Identities = 11/42 (26%), Positives = 26/42 (61%) Frame = -1 Query: 397 YAKVEGLVPERCRNDFPKFRKHTEQKGTTEDNIEKESLKHMI 272 + K+E L P++ + F +F + + K + + N+E + +KH++ Sbjct: 183 HEKLENLTPKQLKEVFSQFLFNNQSKSSLKINLEYKVIKHLL 224
>ULA1_SCHPO (Q9UT93) NEDD8-activating enzyme E1 regulatory subunit| (Ubiquitin-like activation protein 1) (Ubiquitin-activating enzyme E1-like 1) Length = 500 Score = 29.3 bits (64), Expect = 3.9 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = -1 Query: 409 SRDQYAKVEGLVPERCRNDFPKFRKHTEQK----GTTEDNIEKESLKHMILIRRGKLNLQ 242 S QY K++ + E+ ND KF+K+ +Q + + I +KH R LN++ Sbjct: 322 STQQYVKLQVIYKEKSENDILKFKKYVQQTLKRLNRSVEEITDLEIKH---FSRNCLNIK 378 Query: 241 V 239 V Sbjct: 379 V 379
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 29.3 bits (64), Expect = 3.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 66 NYSTILPSYDMLNEQCDQIC 125 N S+ LP +D +N QCD++C Sbjct: 1465 NCSSPLPCWDYINNQCDELC 1484
>ATM_ARATH (Q9M3G7) Serine/threonine-protein kinase ATM (EC 2.7.11.1) (Ataxia| telangiectasia mutated homolog) (AtATM) Length = 3856 Score = 28.9 bits (63), Expect = 5.1 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 5/41 (12%) Frame = +3 Query: 60 SQNYSTIL-----PSYDMLNEQCDQICTQLVQNISQQWYKI 167 S N TIL P+ + EQ +IC +LV SQ W+ + Sbjct: 3166 SSNSRTILEKYLRPAVSLAEEQSSKICKRLVDRQSQTWFHL 3206
>YIF1A_BRARE (Q6PC24) Protein YIF1A (YIP1-interacting factor homolog A)| Length = 307 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 183 VICKITLGSNSYFLILTYSTCKFNFPRLIRIICFRLSFSILSSV 314 V C + GS+ Y++ L +S+C F I L ILSS+ Sbjct: 229 VFCGLLFGSDGYYVALAWSSCALMF-----FIVRSLKMKILSSI 267
>PDE1_YEAST (P22434) 3',5'-cyclic-nucleotide phosphodiesterase 1 (EC 3.1.4.17)| (PDEase 1) (Low-affinity cAMP phosphodiesterase) (3':5'-CNP) Length = 369 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/49 (28%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = -2 Query: 423 VSVVTVVISMPRLKDLYQSAVGMTSLSS-----GNTPSRKEPRKTILRK 292 +S + ++ + L LY S+ G++ L+ +TP++++PR TIL + Sbjct: 295 LSPIYLINELSNLNTLYNSSKGLSGLNVIVTHVKSTPAKRDPRLTILEE 343
>CYAA_SACKL (P23466) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 1839 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 406 RDQYAKVEGLVPERCRNDFPKFRKHTEQKGTTEDNIEKE 290 R+++ ++E E N PKF+KH TT N E + Sbjct: 14 REKHPQIEETFEEHVHNAMPKFKKHYALGITTHTNDEDD 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,769,050 Number of Sequences: 219361 Number of extensions: 1147828 Number of successful extensions: 2867 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2867 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)