Clone Name | rbastl02f12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NUDT3_ARATH (Q8L831) Nudix hydrolase 3 (EC 3.6.1.-) (AtNUDT3) | 70 | 3e-12 | 2 | RT22_HUMAN (P82650) Mitochondrial 28S ribosomal protein S22 (S22... | 32 | 0.95 | 3 | OR30A_DROME (Q9VLE5) Putative odorant receptor 30a | 30 | 2.1 | 4 | TRPE_STRCO (Q9Z4W7) Anthranilate synthase component 1 (EC 4.1.3.... | 29 | 4.7 | 5 | RARB_MOUSE (P22605) Retinoic acid receptor beta (RAR-beta) | 28 | 8.1 |
---|
>NUDT3_ARATH (Q8L831) Nudix hydrolase 3 (EC 3.6.1.-) (AtNUDT3)| Length = 772 Score = 69.7 bits (169), Expect = 3e-12 Identities = 36/64 (56%), Positives = 44/64 (68%) Frame = -2 Query: 449 EEAVESLGREIMTIQAKGDKPAAQSLLQSRATLTQPLRVALEKIEHMQVPVDIAPIFGTA 270 E AVESL EI+TIQ KGDK AA LL T+T PL+ ALE +E ++VPVDI+P F A Sbjct: 708 EGAVESLSHEILTIQGKGDKNAATLLLNKYCTITGPLKTALENLERVKVPVDISPTFPLA 767 Query: 269 SKLL 258 L+ Sbjct: 768 EALM 771
>RT22_HUMAN (P82650) Mitochondrial 28S ribosomal protein S22 (S22mt) (MRP-S22)| Length = 360 Score = 31.6 bits (70), Expect = 0.95 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -3 Query: 280 LAQPVSCSQTIKHQRTRFRKFCATYRVPEKRQPVFLYEKVEIVETR 143 L QP+ CS + R RF A PE ++P F+ E+V+ + T+ Sbjct: 36 LLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTK 81
>OR30A_DROME (Q9VLE5) Putative odorant receptor 30a| Length = 377 Score = 30.4 bits (67), Expect = 2.1 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 234 VLWCLIVCEQLTGCAKYRGYINGHLHMFDFLQCHAQRLC 350 ++WC+ +L+G +N HLH+ +FL C LC Sbjct: 229 IIWCIKYQLKLSGFVDSMNALNTHLHLVEFL-CFGAMLC 266
>TRPE_STRCO (Q9Z4W7) Anthranilate synthase component 1 (EC 4.1.3.27)| (Anthranilate synthase component I) Length = 511 Score = 29.3 bits (64), Expect = 4.7 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +2 Query: 296 QRAPAYVRFSPMPRATAVSRLHGTEGETA 382 +RAPA FS P A A HGT+G TA Sbjct: 210 RRAPAPAAFSGRPLAAATPADHGTQGWTA 238
>RARB_MOUSE (P22605) Retinoic acid receptor beta (RAR-beta)| Length = 482 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +2 Query: 293 YQRAPAYVRFSPMPRATAVSRLHGTEGETAQQAC-RPLPVSS*SLCQ 430 Y AP + F P+ R ++ LHG G C P P S CQ Sbjct: 20 YPAAPYPLLFPPVIRGLSLPPLHGLHGHPPPSGCSTPSPASVGQACQ 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,085,593 Number of Sequences: 219361 Number of extensions: 1266971 Number of successful extensions: 2872 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2872 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)