Clone Name | rbastl02f06 |
---|---|
Clone Library Name | barley_pub |
>SYL_METMA (Q8Q054) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 966 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -3 Query: 351 QTWPYFLAMDGFLSCEGEMATK*NRPVI 268 + WP LA++GF+S EG+ +K P++ Sbjct: 614 EKWPKALAVNGFVSLEGQKMSKSKGPIL 641
>SYL_METAC (Q8TQD3) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 961 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -3 Query: 351 QTWPYFLAMDGFLSCEGEMATK*NRPVI 268 + WP LA++GF+S EG+ +K P++ Sbjct: 614 EKWPRALAVNGFVSLEGQKMSKSKGPIL 641
>ATG26_KLULA (Q6CUV2) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1209 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 349 NMALFFSHGWFFIMRRGNGNQMKQTRNSL 263 N++ + +FF+ +GN N MKQ NSL Sbjct: 356 NLSTYAVDEYFFVFFKGNANAMKQKVNSL 384
>HMCS1_PONPY (Q5R7Z9) Hydroxymethylglutaryl-CoA synthase, cytoplasmic (EC| 2.3.3.10) (HMG-CoA synthase) (3-hydroxy-3-methylglutaryl coenzyme A synthase) Length = 520 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 295 GNQMKQTRNSLAIVIWRSAYCKVARESMTR 206 GN T N +I+ S YCK+ ++S+ R Sbjct: 248 GNDKDFTLNDFGFMIFHSPYCKLVQKSLAR 277
>HMCS1_HUMAN (Q01581) Hydroxymethylglutaryl-CoA synthase, cytoplasmic (EC| 2.3.3.10) (HMG-CoA synthase) (3-hydroxy-3-methylglutaryl coenzyme A synthase) Length = 520 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 295 GNQMKQTRNSLAIVIWRSAYCKVARESMTR 206 GN T N +I+ S YCK+ ++S+ R Sbjct: 248 GNDKDFTLNDFGFMIFHSPYCKLVQKSLAR 277
>SMG_CHRVO (Q7NQ72) Protein smg homolog| Length = 152 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 174 DTKRLLPEATDLVIDSRATLQYADLQITIAKLLRVCFIW 290 D L P ++VID L DL I AKLL + +W Sbjct: 89 DNGALSPAQREMVIDRLLELDPEDLDIDTAKLLVLMVLW 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,344,905 Number of Sequences: 219361 Number of extensions: 866141 Number of successful extensions: 2030 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2030 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)