| Clone Name | rbastl02f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RBBP8_HUMAN (Q99708) Retinoblastoma-binding protein 8 (RBBP-8) (... | 28 | 8.7 | 2 | DNAJ_TETHA (Q93R26) Chaperone protein dnaJ | 28 | 8.7 | 3 | YDFN_BACSU (P96692) Putative NAD(P)H nitroreductase ydfN (EC 1.-... | 28 | 8.7 |
|---|
>RBBP8_HUMAN (Q99708) Retinoblastoma-binding protein 8 (RBBP-8)| (CtBP-interacting protein) (CtIP) (Retinoblastoma-interacting protein and myosin-like) (RIM) Length = 897 Score = 28.5 bits (62), Expect = 8.7 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Frame = +1 Query: 187 EQDNAQKNKKKLSEQY-----NTILHPRARLRCNQDSSVGYQTSEKNFKGLNLL 333 E++ Q+ KKLSEQ N H A L C +D + +F G+N L Sbjct: 123 ERNTLQEENKKLSEQLQQKIENDQQHQAAELECEEDVIPDSPITAFSFSGVNRL 176
>DNAJ_TETHA (Q93R26) Chaperone protein dnaJ| Length = 386 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = +1 Query: 157 LQKSYYSTLVEQDNAQKNKKKLSEQYNTILHPRARLRCNQDSSVGYQTSEKNFKG 321 L K Y+ + ++ +A++ KK + NT+ P+ R +Q G+ ++ NF G Sbjct: 29 LSKKYHPDVNQEADAEEKFKKFQKPMNTLSDPQKRAAYDQ---YGHAGADANFGG 80
>YDFN_BACSU (P96692) Putative NAD(P)H nitroreductase ydfN (EC 1.-.-.-)| Length = 206 Score = 28.5 bits (62), Expect = 8.7 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = +1 Query: 154 NLQKSYYSTLVEQDNAQKNKKKLSEQYNTILHPRARLRCNQDSSVGYQTSEKNFKGLNLL 333 NLQ + Y T+++QD +K K+ + QY + L + YQ + ++GL +L Sbjct: 43 NLQHTKYVTVLDQDVKEKLKQAANGQYKVVSSSAVLLVLGDKQA--YQQAADIYEGLKVL 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,001,365 Number of Sequences: 219361 Number of extensions: 1421531 Number of successful extensions: 3556 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3556 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)