Clone Name | rbastl02f01 |
---|---|
Clone Library Name | barley_pub |
>YLZ5_CAEEL (P34418) Hypothetical protein F42H10.5| Length = 810 Score = 29.3 bits (64), Expect = 2.6 Identities = 21/72 (29%), Positives = 34/72 (47%) Frame = +3 Query: 30 ILPLARPTIS*PTDRG*LH*VLPVKHRNVTFLLSCLCATHTHRLLRYIQFLAANSPQSAL 209 + +A+P S PT+ H V H+ + L S L A+ LL I + A+ + + Sbjct: 312 VFEMAQPKFSIPTESQYEHIVNSTSHKLIQSLKSQLSASKKLNLLLDITKITADISRVTV 371 Query: 210 NSSTTGGNQPSY 245 + + TGG SY Sbjct: 372 SVALTGGAGNSY 383
>ATL4B_ARATH (Q9M0R6) Putative RING-H2 finger protein ATL4B precursor| Length = 302 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -1 Query: 286 VDCVVPPSMRIRKE*LGWLPPVVELFRADCGEFAARNCMYLNRRCVCVAQR 134 V+C + S + KE L W+PP F A+C + ++L+ + C A R Sbjct: 121 VECAICLSEFVDKETLRWMPPCSHTFHANCID------VWLSSQSTCPACR 165
>ATBF1_MOUSE (Q61329) Alpha-fetoprotein enhancer-binding protein (AT motif-binding| factor) (AT-binding transcription factor 1) Length = 3726 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +2 Query: 107 PECYI--SSFLSLRYTHTPPIEIHTVPCRKLAAISPKQLNYGGQPTKLLFPYSH*WR 271 P+C + SS + +H P +HT ++LA + P+ + Y KL FP W+ Sbjct: 2499 PQCPLPQSSPSPSQLSHLPLKPLHTSTPQQLANLPPQLIPYQCDQCKLAFPSFEHWQ 2555
>ATBF1_HUMAN (Q15911) Alpha-fetoprotein enhancer-binding protein (AT motif-binding| factor) (AT-binding transcription factor 1) Length = 3703 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +2 Query: 107 PECYI--SSFLSLRYTHTPPIEIHTVPCRKLAAISPKQLNYGGQPTKLLFPYSH*WR 271 P+C + SS + +H P +HT ++LA + P+ + Y KL FP W+ Sbjct: 2490 PQCPLPQSSPSPSQLSHLPLKPLHTSTPQQLANLPPQLIPYQCDQCKLAFPSFEHWQ 2546
>GPR4_HUMAN (P46093) Probable G-protein coupled receptor 4 (G-protein coupled| receptor 19) Length = 362 Score = 27.3 bits (59), Expect = 9.8 Identities = 28/86 (32%), Positives = 36/86 (41%), Gaps = 19/86 (22%) Frame = +3 Query: 24 YHILPLARPTI--S*PTDRG*LH*VLPVKHRNVTF---------LLSCLC--------AT 146 YH+L L+R I P D G V H ++ F +L CL A Sbjct: 240 YHVLLLSRSAIYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAK 299 Query: 147 HTHRLLRYIQFLAANSPQSALNSSTT 224 H LLR FLA++ PQ N+S T Sbjct: 300 ALHNLLR---FLASDKPQEMANASLT 322 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,622,542 Number of Sequences: 219361 Number of extensions: 910997 Number of successful extensions: 1869 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1869 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)